y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G146800.1
FamilyAA7
Protein PropertiesLength: 576 Molecular Weight: 63549.9 Isoelectric Point: 6.7808
ChromosomeChromosome/Scaffold: 06 Start: 40501514 End: 40510616
DescriptionFAD-linked oxidases family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA71513461.3e-24
  NIPDVVVFPRSEEEVSQIVKSCNKHKVPIVPYGGATSIEGHTLSPNGGVCIDMTLMKRVKALHIRDMDVVVEPGIGWMELNEYLEPYGLFSPLIQVRPGA
  TIGGMCATRCSGSLAVRYGTMRDNVISLKVVLANGDIVKTASRARKSAAGYDLTRLMIGSEGTLGVVTEVTLRLQKIPEHSVVAMCNFPTIKAAAD
Full Sequence
Protein Sequence     Length: 576     Download
MGFSFWLARL RSCSNKSAFS NAFRDSFYHY KSQLNTCQKN LPSTIAEKTN SHAFSWSSCL    60
LPLAFAVSAG SLTFQSHNNH PSLCEPSNLD SRKVTIGGKA STEFVVKGTH KEVPQELIDE    120
LKAICQDNMT LDYDERFYHG KPQNSFHKAV NIPDVVVFPR SEEEVSQIVK SCNKHKVPIV    180
PYGGATSIEG HTLSPNGGVC IDMTLMKRVK ALHIRDMDVV VEPGIGWMEL NEYLEPYGLF    240
SPLIQVRPGA TIGGMCATRC SGSLAVRYGT MRDNVISLKV VLANGDIVKT ASRARKSAAG    300
YDLTRLMIGS EGTLGVVTEV TLRLQKIPEH SVVAMCNFPT IKAAADVAID TMLSGIQVSR    360
VELLDEVQVR AINIANGKNL PEVPTLMFEF IGTKAYSHEQ TQIVQRIVSE HNGSDFVFAE    420
DPEAKKELWK IRKEALWACF AMEPNFEAMI SDVCVPLSNL AELISRSKQE LDASSLVCTV    480
IAHAGDGNFH TVILFDPNEE EHRREAERLN QFMVYTALSM EGTCTGEHGV GTGKMKYLEK    540
ELGIEALQTM KRIKTALDPN NIMNPGKLIP PHVCF*                              600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK11230PRK112302.0e-51152574430+
pfam02913FAD-oxidase_C2.0e-69327568247+
TIGR00387glcD2.0e-95156567423+
COG0277GlcD4.0e-125120571465+
PLN02805PLN02805055575521+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001142976.108757571555hypothetical protein LOC100275430 [Zea mays]
RefSeqNP_568170.105657549567FAD linked oxidase family protein [Arabidopsis thaliana]
RefSeqXP_002267321.1015751566PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002322755.10965751480predicted protein [Populus trichocarpa]
RefSeqXP_002524111.1015751555d-lactate dehydrogenase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3pm9_F2e-3815556954476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_E2e-3815556954476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_D2e-3815556954476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_C2e-3815556954476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_B2e-3815556954476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2650383241674890
DY3055873742075750
EX2616063232245420
EL444323286973820
EX261606505235720.15
Orthologous Group
SpeciesID
Arabidopsis lyrata487468
Brassica rapaBra009208
Carica papayaevm.model.supercontig_222.7
Capsella rubellaCarubv10000524m
Citrus clementinaCiclev10011373m
Citrus sinensisorange1.1g011962morange1.1g015664morange1.1g015624morange1.1g008252m
Cucumis sativusCucsa.242270.1
Eucalyptus grandisEucgr.A02536.1
Fragaria vescamrna18037.1-v1.0-hybrid
Glycine maxGlyma03g36390.2Glyma03g36390.1
Malus domesticaMDP0000293317MDP0000201766
Manihot esculentacassava4.1_004573m
Mimulus guttatusmgv1a003632m
Physcomitrella patensPp1s18_85V6.1
Phaseolus vulgarisPhvul.001G199000.1
Picea abiesMA_9447266g0050
Populus trichocarpaPotri.016G064800.13Potri.016G064800.1Potri.016G064800.10Potri.016G064800.11Potri.016G064800.2
Potri.016G064800.3Potri.016G064800.4Potri.016G064800.5Potri.016G064800.6Potri.016G064800.7
Potri.016G064800.8Potri.016G064800.9Potri.016G064800.12
Prunus persicappa003803m
Ricinus communis29333.m001099
Thellungiella halophilaThhalv10013121m
Vitis viniferaGSVIVT01022507001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny