y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G160600.1
FamilyGT1
Protein PropertiesLength: 493 Molecular Weight: 55367.3 Isoelectric Point: 7.8392
ChromosomeChromosome/Scaffold: 06 Start: 42013755 End: 42015358
DescriptionUDP-glucosyl transferase 73D1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12724651e-35
  KCLKWLDSMKTRSVIYACLGSLCRLVSAQLIELGLGLEASQQPFVWVVKTGNQRANDELEKWFSEHNFEEKIKGRGLIIKGWAPQVLILSHPAIRGFLTH
  CGWNSTLEAVCSGVPMITWPQFSEQFFNEKLIVEILKIGVGVGVEIPVRWGEEEKLGVLVRKEQIVTAIDMLMNGGEEGEKRRMRARELAEMAT
Full Sequence
Protein Sequence     Length: 493     Download
MASVTAKQLH FVLIPLMAQG HMIPMVDMAR LLADRGVIVS LITTPRNASR FDTVIERASE    60
SGLRVRLVKI PFPCQEVGLP IGCENLDTLC SRDLLKKFYN ALDLWREPLE QFLEQQKPQP    120
SCIISDKCLS WTSETAQKFN IPRIVFHGMG CFSLLSSHNV KLHKAHLFVA SDSERFRVPG    180
LPQKVEITRA QLPGTFVSLP DLDDTRNKMQ EAEMNAYGVV INSFNELEHG CVNEYQKAIK    240
KKVWAIGPVS LCNRINLDKF ERGNKASIND NKCLKWLDSM KTRSVIYACL GSLCRLVSAQ    300
LIELGLGLEA SQQPFVWVVK TGNQRANDEL EKWFSEHNFE EKIKGRGLII KGWAPQVLIL    360
SHPAIRGFLT HCGWNSTLEA VCSGVPMITW PQFSEQFFNE KLIVEILKIG VGVGVEIPVR    420
WGEEEKLGVL VRKEQIVTAI DMLMNGGEEG EKRRMRAREL AEMATKAVEN GGSSHLNLSH    480
LVQDILEQVN QL*                                                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00164PLN001643.0e-561490542+
PLN02448PLN024487.0e-5810487505+
PLN02863PLN028631.0e-7710413411+
PLN03007PLN030073.0e-1537485488+
PLN02534PLN0253401492493+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_190883.1064909505UGT73D1 (UDP-glucosyl transferase 73D1); UDP-glycosyltransferase/ transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002265257.1014851482PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323494.1014911490predicted protein [Populus trichocarpa]
RefSeqXP_002326219.1014901489predicted protein [Populus trichocarpa]
RefSeqXP_002519422.1064922486UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A014901482A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A064794461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A064794461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A064794461A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B8.00001e-4174858461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO796875433434720
EG7021472822084880
EG7021362822084880
AM7347012631534150
HO7809403271464710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_01085.1Aquca_009_01087.1Aquca_009_01086.1Aquca_010_00615.1Aquca_010_00616.1
Aquca_001_00790.1Aquca_010_00617.1Aquca_010_00614.1Aquca_039_00199.1Aquca_039_00195.1
Arabidopsis lyrata482660482658902799485691906700
912988899760857153343136491260
Arabidopsis thalianaAT2G36760.1AT2G36800.1AT2G36770.1AT2G36780.1AT2G36750.1
AT2G36790.1AT3G53160.1AT3G53150.1AT2G15490.3AT2G15480.2
AT2G15490.1AT4G34131.1AT2G15480.1AT4G34138.1AT4G34135.1
Brachypodium distachyonBradi2g34090.1Bradi2g04720.1Bradi2g04760.1Bradi2g04747.1Bradi2g04700.1
Bradi1g45090.1Bradi1g61910.1Bradi1g45950.1Bradi3g07750.1Bradi3g07740.1
Bradi1g46070.1Bradi1g61897.1Bradi5g16120.1Bradi3g07770.1Bradi2g34070.1
Bradi2g44785.1Bradi2g44820.1Bradi3g09330.1Bradi4g15480.1Bradi2g34060.1
Bradi1g70260.1Bradi5g16100.1Bradi2g20800.1Bradi1g10280.1
Brassica rapaBra005242Bra005241Bra023081Bra005245Bra005246
Bra017224Bra005243Bra023079Bra006973Bra023080
Bra040690Bra006972Bra006971Bra017463Bra013105
Bra034610Bra034609Bra034608Bra011496Bra011493
Bra016424Bra015219Bra011490Bra011495Bra011492
Carica papayaevm.model.supercontig_5.142evm.model.supercontig_5.139evm.model.supercontig_5.138evm.model.supercontig_5.143evm.model.supercontig_5.146
evm.model.supercontig_5.145evm.model.supercontig_5.137evm.model.supercontig_200.20evm.model.supercontig_21.166evm.TU.contig_30463.2
Capsella rubellaCarubv10023081mCarubv10023077mCarubv10024756mCarubv10025538mCarubv10023061m
Carubv10025042mCarubv10017194mCarubv10018449mCarubv10004508mCarubv10013576m
Carubv10013563mCarubv10007840mCarubv10004704m
Citrus clementinaCiclev10028297mCiclev10028274mCiclev10030204mCiclev10011555mCiclev10012368m
Ciclev10011889mCiclev10028312mCiclev10028248mCiclev10028315mCiclev10013516m
Ciclev10027181mCiclev10027236mCiclev10027579mCiclev10028465mCiclev10013869m
Ciclev10028305mCiclev10010868mCiclev10003977mCiclev10030328mCiclev10028334m
Ciclev10030313mCiclev10013664mCiclev10023414mCiclev10029366m
Citrus sinensisorange1.1g011142morange1.1g037640morange1.1g042970morange1.1g010988morange1.1g011339m
orange1.1g044823morange1.1g046884morange1.1g010940morange1.1g011490morange1.1g039701m
orange1.1g013951morange1.1g046553morange1.1g038151morange1.1g046605morange1.1g010093m
orange1.1g036598morange1.1g048562morange1.1g044012m
Cucumis sativusCucsa.379000.1Cucsa.306450.1Cucsa.365740.1Cucsa.378970.1Cucsa.378990.1
Cucsa.306430.1Cucsa.124930.1Cucsa.219670.1Cucsa.219710.1Cucsa.219690.1
Cucsa.219700.1Cucsa.244540.1Cucsa.234030.1
Eucalyptus grandisEucgr.A01607.1Eucgr.A01606.1Eucgr.A01605.1Eucgr.A01608.1Eucgr.A01611.1
Eucgr.I01123.1Eucgr.I00449.1Eucgr.I00494.1Eucgr.I01116.1Eucgr.I01117.1
Eucgr.E02950.1Eucgr.I00493.1Eucgr.I00448.1Eucgr.I01120.1Eucgr.I00450.1
Eucgr.I00497.1Eucgr.I00445.1Eucgr.I00410.1Eucgr.L03642.1Eucgr.I00492.1
Eucgr.I01115.1Eucgr.I00409.1Eucgr.I00446.1Eucgr.G02440.1Eucgr.E02951.1
Eucgr.C01938.1Eucgr.G02439.1Eucgr.G02262.1Eucgr.G02259.1Eucgr.G01414.1
Eucgr.I01122.1Eucgr.G02266.1Eucgr.I01127.1Eucgr.L01977.1Eucgr.I01125.1
Eucgr.G02260.1Eucgr.I01111.1Eucgr.I01121.1
Fragaria vescamrna00096.1-v1.0-hybridmrna18452.1-v1.0-hybridmrna00094.1-v1.0-hybridmrna09825.1-v1.0-hybridmrna09821.1-v1.0-hybrid
mrna00095.1-v1.0-hybridmrna26345.1-v1.0-hybridmrna00126.1-v1.0-hybridmrna26353.1-v1.0-hybridmrna26356.1-v1.0-hybrid
mrna26352.1-v1.0-hybridmrna26355.1-v1.0-hybridmrna25421.1-v1.0-hybridmrna26354.1-v1.0-hybridmrna26349.1-v1.0-hybrid
mrna26351.1-v1.0-hybridmrna26344.1-v1.0-hybridmrna00125.1-v1.0-hybridmrna26341.1-v1.0-hybridmrna26305.1-v1.0-hybrid
mrna26347.1-v1.0-hybridmrna26342.1-v1.0-hybridmrna00123.1-v1.0-hybrid
Glycine maxGlyma19g37100.1Glyma03g34410.1Glyma03g34470.1Glyma03g34420.1Glyma19g37116.1
Glyma03g34460.1Glyma10g07090.1Glyma03g34480.1Glyma03g34440.1Glyma19g37108.1
Glyma10g07160.1Glyma19g37140.1Glyma18g50980.1Glyma02g11711.2Glyma02g11711.1
Glyma02g11640.1Glyma02g11680.1Glyma02g11666.1Glyma02g11630.1Glyma07g33880.1
Glyma11g00230.1Glyma02g11610.1Glyma02g11690.1Glyma18g44000.1Glyma18g43980.1
Glyma10g42680.1Glyma09g41700.1Glyma07g38460.1Glyma17g02280.1Glyma17g02290.1
Glyma07g38470.1Glyma17g02270.1Glyma15g34720.1Glyma01g39570.2Glyma07g38465.1
Glyma16g03760.1Glyma18g44010.1Glyma01g05500.1Glyma16g03760.2Glyma11g05680.2
Glyma02g11653.1.269.379Glyma02g11653.1.269.379Glyma08g46270.1Glyma09g41690.1Glyma10g07110.1
Glyma08g46280.1Glyma20g24360.2
Gossypium raimondiiGorai.013G181400.1Gorai.011G202900.1Gorai.013G181500.1Gorai.004G173100.1Gorai.006G160700.1
Gorai.002G160500.1Gorai.009G411800.1Gorai.002G087200.1Gorai.009G411900.1Gorai.009G411700.1
Gorai.007G372300.1Gorai.002G107900.1Gorai.010G022300.1Gorai.008G023900.1Gorai.013G046100.2
Gorai.013G046100.1Gorai.012G149600.1Gorai.013G046200.1Gorai.009G034100.1Gorai.006G185400.1
Linum usitatissimumLus10003322Lus10014404Lus10014402Lus10027739Lus10014437
Lus10023894Lus10014401Lus10014403Lus10016268Lus10003323
Lus10023893Lus10012011Lus10014082Lus10019833Lus10014079
Lus10023939Lus10014086Lus10019831Lus10019835Lus10014084
Lus10019832Lus10010239Lus10014083Lus10014080Lus10010240
Malus domesticaMDP0000499733MDP0000124626MDP0000505274MDP0000846257MDP0000012534
MDP0000885995MDP0000864442MDP0000192448MDP0000071677MDP0000012541
MDP0000843191MDP0000904421
Manihot esculentacassava4.1_006160mcassava4.1_006271mcassava4.1_026786mcassava4.1_026345mcassava4.1_033869m
cassava4.1_034384mcassava4.1_033168mcassava4.1_006471mcassava4.1_006691mcassava4.1_029076m
cassava4.1_030942mcassava4.1_006741mcassava4.1_029292mcassava4.1_023510mcassava4.1_025417m
cassava4.1_006629mcassava4.1_025170mcassava4.1_034435m
Medicago truncatulaMedtr4g031800.1Medtr7g102460.1Medtr7g102490.1Medtr7g102450.1Medtr4g024020.1
Medtr7g102560.1Medtr5g045960.1Medtr5g045970.1Medtr3g044670.1Medtr7g102550.1
Medtr7g102520.1Medtr8g066610.1Medtr7g070610.1Medtr4g108250.1Medtr7g055710.1
Medtr7g012120.1Medtr7g071040.1Medtr7g070930.1Medtr7g070940.1Medtr7g070660.1
Medtr7g070800.1Medtr7g071050.1Medtr5g040030.1Medtr5g067170.1Medtr7g070780.1
Medtr7g070860.1AC235663_17.1Medtr2g035040.1AC235663_24.1AC235663_19.1
Medtr2g035020.1AC235663_22.1AC235663_28.1Medtr8g044140.1Medtr2g034990.1
Medtr5g029800.1Medtr7g070910.1Medtr5g016660.1Medtr7g070740.1Medtr5g039900.1
AC235663_25.1AC234952_10.1Medtr8g056740.1AC235673_41.1Medtr7g070810.1
Medtr7g071000.1Medtr7g070870.1Medtr7g070760.1
Mimulus guttatusmgv1a005332mmgv1a025584mmgv1a019869mmgv1a018066mmgv1a005524m
mgv1a005154mmgv1a004897mmgv1a018398mmgv1a006196mmgv1a026287m
mgv1a005507m
Oryza sativaLOC_Os01g08110.1LOC_Os01g08090.1LOC_Os01g08100.1LOC_Os10g09990.1LOC_Os02g11110.2
LOC_Os02g11110.1LOC_Os02g11130.1LOC_Os01g41430.1LOC_Os02g11700.1LOC_Os05g08510.1
LOC_Os01g45140.1LOC_Os01g45110.1LOC_Os02g11640.1LOC_Os03g59350.1LOC_Os03g11350.1
LOC_Os04g44250.1LOC_Os05g08480.1LOC_Os04g44240.1LOC_Os03g46400.1LOC_Os05g42020.1
LOC_Os01g41450.1LOC_Os05g42060.1LOC_Os03g24430.1LOC_Os03g53350.1LOC_Os02g11670.1
Panicum virgatumPavirv00012201mPavirv00047047mPavirv00033626mPavirv00003912mPavirv00002161m
Pavirv00016994mPavirv00061505mPavirv00028225mPavirv00034734mPavirv00059461m
Pavirv00069988mPavirv00037416mPavirv00057843mPavirv00021964mPavirv00028237m
Pavirv00054326mPavirv00033914mPavirv00054408mPavirv00015778mPavirv00023066m
Pavirv00054568mPavirv00009783mPavirv00024544mPavirv00005377mPavirv00023064m
Pavirv00064537mPavirv00009375mPavirv00036297mPavirv00002336mPavirv00044460m
Pavirv00036355mPavirv00050501mPavirv00036162mPavirv00033711mPavirv00010829m
Pavirv00051917mPavirv00069830mPavirv00043029mPavirv00045738mPavirv00061506m
Pavirv00028726mPavirv00002556mPavirv00055185mPavirv00034761mPavirv00056735m
Pavirv00059209mPavirv00059208mPavirv00046009mPavirv00064044mPavirv00016277m
Pavirv00059239mPavirv00065519m
Phaseolus vulgarisPhvul.003G047200.1Phvul.001G182100.1Phvul.001G182600.1Phvul.001G182500.1Phvul.001G182700.1
Phvul.001G182200.1Phvul.001G182900.2Phvul.001G182900.1Phvul.001G182400.1Phvul.007G152800.1
Phvul.001G183000.1Phvul.001G182300.1Phvul.008G026100.3Phvul.008G026100.2Phvul.008G026100.1
Phvul.001G182800.1Phvul.003G046900.1Phvul.003G047100.1Phvul.002G054100.1Phvul.008G090600.1
Phvul.002G093300.1Phvul.010G101800.1Phvul.008G090800.1Phvul.010G101600.1Phvul.003G047000.1
Phvul.002G016500.1Phvul.003G097200.1Phvul.003G097300.1Phvul.003G097400.1Phvul.002G016400.1
Phvul.008G090500.1Phvul.007G020800.1Phvul.007G020700.1Phvul.007G020600.1Phvul.008G090700.1
Phvul.008G091000.1Phvul.008G090900.1Phvul.008G131100.1
Picea abiesMA_10426914g0010MA_159942g0010MA_127040g0010
Populus trichocarpaPotri.012G048700.1Potri.006G120600.1Potri.016G097400.1Potri.001G303000.1Potri.001G303600.1
Potri.001G303300.1Potri.009G099000.1Potri.001G303700.1Potri.001G302400.1Potri.009G098400.1
Potri.001G303200.1Potri.001G303100.1Potri.001G302300.1Potri.002G123700.1Potri.014G082500.1
Potri.001G303800.1
Prunus persicappa004804mppa004786mppa004825mppa014729mppa019633m
ppa018454mppa018836mppa014816mppa004924mppa019699m
ppa015133mppa018059m.555.746ppa018059m.555.746ppa019354mppa016033m
ppa004972mppa005572mppb016539mppa017305mppa005517m
ppa018059m.271.380ppa018059m.271.380
Ricinus communis29579.m00019830078.m00221930078.m00221630078.m00223630078.m002239
30078.m00221729801.m00314329801.m00313629801.m00314029801.m003137
29801.m00314429801.m00313830170.m01384029801.m00312729801.m003141
29801.m00314229801.m00315429801.m003139
Setaria italicaSi001162mSi001042mSi019404mSi020226mSi008192m
Si008078mSi035284mSi040642mSi001241mSi021874m
Si021871mSi017028mSi016382mSi021892mSi009948m
Si026276mSi009942mSi011660mSi017116mSi039095m
Si024831mSi039501mSi021855mSi025159mSi009923m
Sorghum bicolorSb03g004140.1Sb03g004130.1Sb03g004150.1Sb03g004160.1Sb04g007220.1
Sb10g007920.1Sb03g029060.1Sb03g029080.1Sb10g007060.1Sb04g007210.1
Sb06g022940.1Sb03g029070.1Sb09g024640.1Sb02g038560.1Sb01g043140.1
Sb01g008370.1Sb02g038560.2Sb09g005360.1Sb05g024890.1Sb04g007230.1
Sb07g002470.1Sb09g024630.1Sb06g031630.1Sb06g022950.1Sb09g024660.1
Thellungiella halophilaThhalv10017544mThhalv10016560mThhalv10016558mThhalv10010314mThhalv10011062m
Thhalv10022663mThhalv10024935mThhalv10025048m
Vitis viniferaGSVIVT01033701001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)