y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G173000.1
FamilyGT59
Protein PropertiesLength: 511 Molecular Weight: 58254.8 Isoelectric Point: 9.7765
ChromosomeChromosome/Scaffold: 06 Start: 43211875 End: 43215027
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT59244630
  IVPDPYMDEIFHIPQAQKYCNGDFMSWDPMITTPPGLYYLSLVHVAALLPSKYVLQLASSFPEACSTAVLRSVNGVLAVLCSIIVYEIITHLRPAFDDRK
  ATLFAAVLALYPLHWFFTFLYYTDVASLTAVLAMYLACLKKKYLFSALLGAMAVVIRQTNIIWMLFVACSGVIDITMAHQKDSVEVDDSKASNKGTNLSA
  LNTSVNVSSNLKRRKSRGNSKANQHIFYPSNASSASPTLGLLHEIQAIVLSSWRMKWELLVSFSPFFFVLLAFVAFLLWNGSVVLGAKEAHAVSPHFAQI
  MYFSIVSTLFAAPLHFTIGHALDLFQSFWKNRLLGFLLLFLASIASLLSVHFFSIAHPYLLADNRHYTFYLWRKIIIFHWSMKYLLVPFYVYSWFSIFRL
  LGKTRMRIWTLVYFFATSAVLIPAPLIEFRYYTIPFYFFI
Full Sequence
Protein Sequence     Length: 511     Download
MGRIATAAIV SLWVIPVSVL VNRIVPDPYM DEIFHIPQAQ KYCNGDFMSW DPMITTPPGL    60
YYLSLVHVAA LLPSKYVLQL ASSFPEACST AVLRSVNGVL AVLCSIIVYE IITHLRPAFD    120
DRKATLFAAV LALYPLHWFF TFLYYTDVAS LTAVLAMYLA CLKKKYLFSA LLGAMAVVIR    180
QTNIIWMLFV ACSGVIDITM AHQKDSVEVD DSKASNKGTN LSALNTSVNV SSNLKRRKSR    240
GNSKANQHIF YPSNASSASP TLGLLHEIQA IVLSSWRMKW ELLVSFSPFF FVLLAFVAFL    300
LWNGSVVLGA KEAHAVSPHF AQIMYFSIVS TLFAAPLHFT IGHALDLFQS FWKNRLLGFL    360
LLFLASIASL LSVHFFSIAH PYLLADNRHY TFYLWRKIII FHWSMKYLLV PFYVYSWFSI    420
FRLLGKTRMR IWTLVYFFAT SAVLIPAPLI EFRYYTIPFY FFILHTSIND SRSWLLIGIL    480
YTVLNAFTMT MFLFRPFHWD HVPGVQRFIW *                                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG104.0e-42302464163+
pfam04922DIE2_ALG102.0e-5222207187+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85546.1015101498putative protein [Arabidopsis thaliana]
EMBLCAN64153.102851028517hypothetical protein [Vitis vinifera]
RefSeqNP_195861.2015101509DIE2/ALG10 family [Arabidopsis thaliana]
RefSeqXP_002270322.102851028510PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002509451.102737627376conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
426
5981
91113
126148
168190
286308
323345
357379
399421
433455
475497
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DN49573823812380
HS40986926212620
JG63833127672810
EH71956428612810
FS33453820512050
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2Bradi5g14887.1
Brassica rapaBra005722
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2
Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.2.24.120Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny