y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G173000.2
FamilyGT59
Protein PropertiesLength: 463 Molecular Weight: 52788.2 Isoelectric Point: 9.838
ChromosomeChromosome/Scaffold: 06 Start: 43211940 End: 43214999
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT59241202e-35
  IVPDPYMDEIFHIPQAQKYCNGDFMSWDPMITTPPGLYYLSLVHVAALLPSKYVLQLASSFPEACSTAVLRSVNGVLAVLCSIIVYEIITHLRPAFD
GT591244150
  LGAMAVVIRQTNIIWMLFVACSGVIDITMAHQKDSVEVDDSKASNKGTNLSALNTSVNVSSNLKRRKSRGNSKANQHIFYPSNASSASPTLGLLHEIQAI
  VLSSWRMKWELLVSFSPFFFVLLAFVAFLLWNGSVVLGAKEAHAVSPHFAQIMYFSIVSTLFAAPLHFTIGHALDLFQSFWKNRLLGFLLLFLASIASLL
  SVHFFSIAHPYLLADNRHYTFYLWRKIIIFHWSMKYLLVPFYVYSWFSIFRLLGKTRMRIWTLVYFFATSAVLIPAPLIEFRYYTIPFYFFI
Full Sequence
Protein Sequence     Length: 463     Download
MGRIATAAIV SLWVIPVSVL VNRIVPDPYM DEIFHIPQAQ KYCNGDFMSW DPMITTPPGL    60
YYLSLVHVAA LLPSKYVLQL ASSFPEACST AVLRSVNGVL AVLCSIIVYE IITHLRPAFD    120
DRKLGAMAVV IRQTNIIWML FVACSGVIDI TMAHQKDSVE VDDSKASNKG TNLSALNTSV    180
NVSSNLKRRK SRGNSKANQH IFYPSNASSA SPTLGLLHEI QAIVLSSWRM KWELLVSFSP    240
FFFVLLAFVA FLLWNGSVVL GAKEAHAVSP HFAQIMYFSI VSTLFAAPLH FTIGHALDLF    300
QSFWKNRLLG FLLLFLASIA SLLSVHFFSI AHPYLLADNR HYTFYLWRKI IIFHWSMKYL    360
LVPFYVYSWF SIFRLLGKTR MRIWTLVYFF ATSAVLIPAP LIEFRYYTIP FYFFILHTSI    420
NDSRSWLLIG ILYTVLNAFT MTMFLFRPFH WDHVPGVQRF IW*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG103.0e-2522159187+
pfam04922DIE2_ALG102.0e-43254416163+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85546.1014621498putative protein [Arabidopsis thaliana]
EMBLCAN64153.102846228517hypothetical protein [Vitis vinifera]
RefSeqNP_195861.2014621509DIE2/ALG10 family [Arabidopsis thaliana]
RefSeqXP_002270322.102846228510PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002509451.102732827376conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
726
5678
91113
128150
238260
275297
309331
351373
385407
427449
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2672952831774590
DR9317122562084630
DT4881882452194630
HO8071392052594630
EV5398352122544630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2Bradi5g14887.1
Brassica rapaBra005722
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2
Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120
Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny