y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G173000.3
FamilyGT59
Protein PropertiesLength: 234 Molecular Weight: 27720 Isoelectric Point: 10.2092
ChromosomeChromosome/Scaffold: 06 Start: 43212015 End: 43213396
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT5921860
  KWELLVSFSPFFFVLLAFVAFLLWNGSVVLGAKEAHAVSPHFAQIMYFSIVSTLFAAPLHFTIGHALDLFQSFWKNRLLGFLLLFLASIASLLSVHFFSI
  AHPYLLADNRHYTFYLWRKIIIFHWSMKYLLVPFYVYSWFSIFRLLGKTRMRIWTLVYFFATSAVLIPAPLIEFRYYTIPFYFFI
Full Sequence
Protein Sequence     Length: 234     Download
MKWELLVSFS PFFFVLLAFV AFLLWNGSVV LGAKEAHAVS PHFAQIMYFS IVSTLFAAPL    60
HFTIGHALDL FQSFWKNRLL GFLLLFLASI ASLLSVHFFS IAHPYLLADN RHYTFYLWRK    120
IIIFHWSMKY LLVPFYVYSW FSIFRLLGKT RMRIWTLVYF FATSAVLIPA PLIEFRYYTI    180
PFYFFILHTS INDSRSWLLI GILYTVLNAF TMTMFLFRPF HWDHVPGVQR FIW*          240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG102.0e-3825187163+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85546.1034233308498putative protein [Arabidopsis thaliana]
GenBankEEE61284.1034233282481hypothetical protein OsJ_15367 [Oryza sativa Japonica Group]
RefSeqNP_001053242.1034233298497Os04g0503700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_195861.2034233308509DIE2/ALG10 family [Arabidopsis thaliana]
RefSeqXP_002270322.101233278510PREDICTED: hypothetical protein [Vitis vinifera]
Transmembrane Domains
StartEnd
729
4466
79101
121143
156178
198220
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX26729523012300
HO807139205302340
EV539835212252340
DT488188210252340
DK559455212252340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2Bradi5g14887.1
Brassica rapaBra005722
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma07g15720.2Glyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2
Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny