y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G176400.1
FamilyPL1
Protein PropertiesLength: 370 Molecular Weight: 41480.8 Isoelectric Point: 7.9668
ChromosomeChromosome/Scaffold: 06 Start: 43446936 End: 43449512
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11012800
  IVFEVSGTIHLSSTLSVSSYKTIDGRGQRIKLTGKGLRLKECEHVIVCNLEFEGGRGPDVDGIQIKPNSKHIWIDRCSLHDYDDGLIDITRGSTDITVSR
  CHFAQHDKTMLIGADPSHVGDRCIRVTIHHCFFDGTRQRHPRVRYGKVHLYNNYTRNWGIYAVCASVESQIYSQCNIYEA
Full Sequence
Protein Sequence     Length: 370     Download
MGNAHPHRKH RNHHHHPTPT PPYYISPQPY VPSYMPQPHM PHSLPYLNVD SSLRALAGQA    60
EGFGRFAIGG LHGPIYHVTT LSDDGPGSLR DGCRRKEPLW IVFEVSGTIH LSSTLSVSSY    120
KTIDGRGQRI KLTGKGLRLK ECEHVIVCNL EFEGGRGPDV DGIQIKPNSK HIWIDRCSLH    180
DYDDGLIDIT RGSTDITVSR CHFAQHDKTM LIGADPSHVG DRCIRVTIHH CFFDGTRQRH    240
PRVRYGKVHL YNNYTRNWGI YAVCASVESQ IYSQCNIYEA GQKKVAFKYL HEKAADKDEA    300
CSGCIRSEGD LFMTGTQAGL LTENVMSNMF HPSEYYPTWT VEPPSEALKH IVQQFTGWQS    360
VPRPAEASS*                                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C2.0e-3996276201+
COG3866PelB1.0e-4869354305+
smart00656Amb_all1.0e-68105281189+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK93648.1013661380unknown [Populus trichocarpa]
GenBankABK96132.1013661383unknown [Populus trichocarpa]
EMBLCBI32661.10443694327unnamed protein product [Vitis vinifera]
RefSeqXP_002277576.1013691371PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309435.10403661327predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B2.99878e-434833613327A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A2.99878e-434833613327A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A8e-266827822246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A3e-25117278130330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3vmw_A3e-2112227982247A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY275282326433670
DT548594257232790
DY289690316323430
DY277275310443530
DY978143293353210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)