y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G207200.1
FamilyCE16
Protein PropertiesLength: 408 Molecular Weight: 45753.1 Isoelectric Point: 5.288
ChromosomeChromosome/Scaffold: 06 Start: 46251581 End: 46254042
DescriptionSGNH hydrolase-type esterase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE161453806e-26
  NYASAAAGIIFSSGSELGQHISLTHQIQQFSDTYQQFVLSLGEDVAIDLISSSVLYVSIGINDYIHYYLRNVSNVQNLYLPWGFNQFLASTMRQEIKNLY
  NTNVRRFVVMGLPPIGCAPYYLQRYKSNNGECVEEINDMIMEFNFFMRYMTDELLHELPDAGIIFCDVFQGSMDIIRNHKSYGFESTANACCGLGKYNGW
  MMCMSPQMACRNASDHIWWDQFHPTDAVNAILADNV
Full Sequence
Protein Sequence     Length: 408     Download
MLTTHLLAIF LVSAIVAHSK ALRFPQELYN LSSNQIFIVD NLSRPPSSSA SPTPLLSPAV    60
SSPLVPALFI IGDSTVDCGN NNYLGTFARA DRPPYGRDFD THLPTGRFCN GRIPVDYLAL    120
HLGLPFVPNY LGQTGELEDM LHGVNYASAA AGIIFSSGSE LGQHISLTHQ IQQFSDTYQQ    180
FVLSLGEDVA IDLISSSVLY VSIGINDYIH YYLRNVSNVQ NLYLPWGFNQ FLASTMRQEI    240
KNLYNTNVRR FVVMGLPPIG CAPYYLQRYK SNNGECVEEI NDMIMEFNFF MRYMTDELLH    300
ELPDAGIIFC DVFQGSMDII RNHKSYGFES TANACCGLGK YNGWMMCMSP QMACRNASDH    360
IWWDQFHPTD AVNAILADNV WSSRHTEMCY PMNLEKMVFS QSLNNLV*                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00657Lipase_GDSL1.0e-7190380200+
COG3240COG32405.0e-11200382183+
cd01846fatty_acyltransferase_like1.0e-2769380318+
PLN03156PLN031567.0e-6570380317+
cd01837SGNH_plant_lipase_like6.0e-11369384317+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC33954.1053400308649similar to the GDSL family of lipolytic enzymes [Arabidopsis thaliana]
EMBLCBI34498.10640274472unnamed protein product [Vitis vinifera]
RefSeqNP_567372.1014007400GDSL-motif lipase/hydrolase family protein [Arabidopsis thaliana]
RefSeqXP_002265404.1064028406PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002509978.1013981404zinc finger protein, putative [Ricinus communis]
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BG443933253272790
DT7487942591403980
DT7633562391603980
BG5986962391603980
CV6272662451103500
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_008_00177.1Aquca_002_00982.1Aquca_014_00078.1Aquca_014_00039.1Aquca_006_00239.1
Aquca_022_00040.1Aquca_033_00142.1Aquca_108_00006.2Aquca_035_00112.1Aquca_108_00006.1
Aquca_108_00008.1Aquca_002_00960.1Aquca_018_00180.1Aquca_006_00366.2Aquca_039_00166.1
Aquca_038_00206.1Aquca_108_00005.1Aquca_001_00203.1Aquca_022_00041.1Aquca_011_00044.1
Aquca_006_00380.1Aquca_051_00086.1Aquca_051_00085.1Aquca_002_00620.1Aquca_033_00142.2
Aquca_010_00329.1Aquca_007_00465.1Aquca_002_00957.1Aquca_037_00218.1Aquca_002_00958.1.108.341
Aquca_002_00958.1.108.341Aquca_002_00958.1.470.703Aquca_002_00958.1.470.703Aquca_043_00090.1Aquca_002_00956.1
Aquca_043_00084.1Aquca_002_00959.1
Arabidopsis lyrata909546473537355138473170473169
348149494417492964915619476288
493746895314856104495588481221
319861489935319858480827
Arabidopsis thalianaAT1G71250.1AT5G15720.1AT1G29670.1AT3G50400.1AT5G45670.1
AT4G18970.2AT4G18970.1AT1G29660.1AT5G33370.1AT1G71691.2
AT5G37690.1AT2G03980.1AT1G74460.1AT1G71691.1AT5G41890.1
AT5G55050.1AT2G23540.1AT4G10950.1AT2G19010.1AT2G19050.1
Brachypodium distachyonBradi2g25070.1Bradi2g49781.2Bradi3g13585.1Bradi2g19650.1Bradi3g28100.1
Bradi3g12730.1Bradi5g15160.1Bradi3g55270.1Bradi1g64327.1Bradi1g15547.1
Bradi1g45140.1Bradi1g44080.1Bradi5g19050.1Bradi1g18470.1Bradi3g56897.1
Bradi3g01797.1Bradi1g37880.1Bradi3g51720.1
Brassica rapaBra006318Bra034459Bra012728Bra010821Bra035264
Bra025064Bra017597Bra030155Bra030156Bra002936
Bra003920Bra030009Bra016130Bra008151Bra003799
Bra039205Bra032162Bra010820Bra023534Bra012563
Bra002937Bra028143Bra038560Bra028995Bra035549
Bra028996Bra024451Bra028994
Carica papayaevm.model.supercontig_249.15evm.model.supercontig_17.160evm.model.supercontig_12.287evm.model.supercontig_51.29evm.model.supercontig_51.31
evm.model.supercontig_51.28evm.model.supercontig_51.24evm.model.supercontig_1111.3evm.model.supercontig_1620.2evm.model.supercontig_1973.2
evm.model.supercontig_15.147evm.model.supercontig_138.41evm.model.supercontig_571.1
Capsella rubellaCarubv10001233mCarubv10022173mCarubv10006620mCarubv10009525mCarubv10009519m
Carubv10017460mCarubv10005096mCarubv10021728mCarubv10007145mCarubv10026655m
Carubv10015855mCarubv10017495mCarubv10006754mCarubv10023416mCarubv10020505m
Carubv10007532mCarubv10003218mCarubv10015581mCarubv10026598mCarubv10015923m
Citrus clementinaCiclev10023910mCiclev10020332mCiclev10024521mCiclev10015686mCiclev10008725m
Ciclev10033835mCiclev10020709mCiclev10020640mCiclev10020515mCiclev10005252m
Ciclev10013564mCiclev10001655mCiclev10023301mCiclev10013602mCiclev10021468m
Ciclev10025863mCiclev10027519mCiclev10023992mCiclev10027459mCiclev10013555m
Citrus sinensisorange1.1g036887morange1.1g038262morange1.1g041652morange1.1g017552morange1.1g017181m
orange1.1g017684morange1.1g047206morange1.1g047579morange1.1g048665morange1.1g047500m
orange1.1g043726morange1.1g043563morange1.1g041889morange1.1g022934morange1.1g017122m
orange1.1g043504morange1.1g027935morange1.1g048375m
Cucumis sativusCucsa.236910.1Cucsa.073980.1Cucsa.134580.1Cucsa.212710.1Cucsa.047290.1
Cucsa.027590.1Cucsa.060120.1Cucsa.079830.1Cucsa.375170.1Cucsa.252500.1
Cucsa.197740.1Cucsa.366460.1Cucsa.060100.1Cucsa.304270.1
Eucalyptus grandisEucgr.F04092.1Eucgr.E02867.1Eucgr.F02859.1Eucgr.H00825.2Eucgr.H00825.1
Eucgr.F00746.1Eucgr.B02164.1Eucgr.H04197.1Eucgr.K03589.1Eucgr.B02163.2
Eucgr.B02163.1Eucgr.F02635.2Eucgr.I02076.1Eucgr.H01970.1Eucgr.F02635.1
Eucgr.D00409.1Eucgr.H05057.1Eucgr.F02957.1Eucgr.I02073.1Eucgr.K02477.1
Eucgr.B00513.1Eucgr.I02074.1Eucgr.A00381.1Eucgr.D00411.1Eucgr.I01017.1
Eucgr.D01753.1
Fragaria vescamrna27099.1-v1.0-hybridmrna24857.1-v1.0-hybridmrna30527.1-v1.0-hybridmrna05102.1-v1.0-hybridmrna16712.1-v1.0-hybrid
mrna17102.1-v1.0-hybridmrna08402.1-v1.0-hybridmrna31181.1-v1.0-hybridmrna05103.1-v1.0-hybridmrna13085.1-v1.0-hybrid
mrna29434.1-v1.0-hybridmrna26019.1-v1.0-hybridmrna01892.1-v1.0-hybridmrna17103.1-v1.0-hybridmrna05101.1-v1.0-hybrid
mrna17173.1-v1.0-hybridmrna27504.1-v1.0-hybridmrna32129.1-v1.0-hybrid
Glycine maxGlyma06g48250.1Glyma09g36850.2Glyma04g43480.1Glyma08g12750.1Glyma05g29630.1
Glyma06g16970.1Glyma09g03954.1Glyma17g03750.2Glyma07g36790.2Glyma15g09560.1
Glyma19g07055.1Glyma19g07030.1Glyma19g07080.1Glyma19g07000.1Glyma10g31160.1
Glyma13g07840.1Glyma05g24330.1Glyma13g07770.1Glyma03g41330.1Glyma19g06890.1
Glyma19g43950.1Glyma09g37640.1Glyma18g48980.1Glyma19g04890.2Glyma20g36350.1
Glyma19g43920.1Glyma10g31170.1Glyma13g29490.1Glyma03g16140.1Glyma14g02570.1
Glyma02g41210.1Glyma02g06960.1Glyma01g38850.1Glyma14g39490.1Glyma11g06360.1
Glyma16g26020.1Glyma18g10820.1Glyma08g43080.1Glyma15g09540.1Glyma17g10900.1
Glyma05g00990.1Glyma04g33430.2Glyma04g33430.1Glyma06g20900.1Glyma16g22860.1
Glyma15g14930.1Glyma01g43590.1Glyma02g04910.1Glyma01g09190.1
Gossypium raimondiiGorai.009G265600.1Gorai.005G117500.1Gorai.011G200700.1Gorai.010G240200.1Gorai.013G136800.1
Gorai.007G271700.1Gorai.013G188900.1Gorai.001G235500.1Gorai.004G249800.1Gorai.013G119300.1
Gorai.013G119200.1Gorai.013G158800.1Gorai.013G188900.2Gorai.004G249700.1Gorai.004G249800.2
Gorai.005G117500.2Gorai.002G090200.1Gorai.006G002200.1Gorai.007G067600.2Gorai.004G064300.1
Gorai.004G249700.2Gorai.006G038300.1Gorai.007G037900.1Gorai.006G267100.1Gorai.002G202200.1
Gorai.010G237000.1Gorai.008G071700.1Gorai.009G159200.1Gorai.008G259200.1Gorai.009G440500.1
Gorai.011G103900.1Gorai.011G103900.2Gorai.007G190000.1Gorai.007G067600.1Gorai.009G159200.2
Gorai.011G035400.1Gorai.009G151000.1Gorai.006G258100.1Gorai.011G035400.2Gorai.003G004500.1
Gorai.009G287500.1Gorai.009G159200.3Gorai.011G035400.3
Linum usitatissimumLus10016929Lus10039152Lus10005236Lus10005238Lus10002775
Lus10011998Lus10011997Lus10016918Lus10041847Lus10011996
Lus10003106Lus10022471Lus10016775Lus10039877Lus10002777
Lus10001540Lus10018641Lus10001643Lus10021664Lus10025105
Lus10023979Lus10019095Lus10034459Lus10021540Lus10015242
Lus10040064Lus10021543Lus10032399Lus10028686Lus10028738
Lus10005413Lus10001532
Malus domesticaMDP0000300103MDP0000496435MDP0000184619MDP0000149267MDP0000268854
MDP0000476415MDP0000194060MDP0000696168MDP0000496434MDP0000444114
MDP0000296512MDP0000218469MDP0000302547MDP0000140292MDP0000119418
MDP0000226662MDP0000266176MDP0000306072MDP0000293103MDP0000286698
MDP0000660239MDP0000625959MDP0000284618MDP0000208568MDP0000248983
MDP0000179808MDP0000213057MDP0000209081MDP0000280992MDP0000217651
MDP0000199411
Manihot esculentacassava4.1_026661mcassava4.1_029883mcassava4.1_009933mcassava4.1_010141mcassava4.1_010094m
cassava4.1_021865mcassava4.1_010401mcassava4.1_032666mcassava4.1_031824mcassava4.1_032885m
cassava4.1_010082mcassava4.1_010409mcassava4.1_025413mcassava4.1_033053mcassava4.1_026527m
cassava4.1_024612mcassava4.1_028078mcassava4.1_021837mcassava4.1_021374mcassava4.1_033875m
cassava4.1_025139m
Medicago truncatulaMedtr3g005650.1Medtr4g035360.1Medtr8g087890.1Medtr2g033920.1Medtr3g098270.1
Medtr1g079540.1Medtr1g079600.1Medtr1g024890.1Medtr4g122200.1Medtr7g116520.1
Medtr6g021530.1Medtr8g074570.1Medtr3g021460.1Medtr5g078210.1Medtr2g033930.1
Medtr3g052490.1Medtr8g074560.1Medtr5g093090.1Medtr3g052480.1Medtr3g052580.1
Medtr5g009100.1
Mimulus guttatusmgv1a026796mmgv1a008354mmgv1a007347mmgv1a008192mmgv1a008629m
mgv1a008614mmgv1a008571mmgv1a008648mmgv1a009318mmgv1a008646m
mgv1a018005mmgv1a008471mmgv1a007719mmgv1a026492mmgv1a022138m
mgv1a024192mmgv1a009926mmgv1a008749mmgv1a008771m
Oryza sativaLOC_Os08g02094.1LOC_Os05g34700.1LOC_Os08g45150.1LOC_Os10g32580.1LOC_Os01g52770.1
LOC_Os05g44200.1LOC_Os02g57110.1LOC_Os02g40440.1LOC_Os01g54470.1LOC_Os03g19670.1
LOC_Os04g42860.1LOC_Os05g34700.2LOC_Os03g38470.1LOC_Os03g19670.2LOC_Os06g12410.1
LOC_Os02g57110.2LOC_Os07g47210.1LOC_Os06g36520.1LOC_Os06g14630.1LOC_Os02g18870.1
LOC_Os06g50940.1LOC_Os02g19040.1LOC_Os03g38390.1
Panicum virgatumPavirv00030835mPavirv00001825mPavirv00014538mPavirv00024374mPavirv00003397m
Pavirv00025711mPavirv00035322mPavirv00016976mPavirv00055951mPavirv00069836m
Pavirv00041085mPavirv00065618mPavirv00007559mPavirv00004298mPavirv00001623m
Pavirv00068568mPavirv00001544mPavirv00048191mPavirv00004393mPavirv00024677m
Pavirv00029008mPavirv00035992mPavirv00003462mPavirv00012745mPavirv00027508m
Pavirv00009919mPavirv00047049mPavirv00003652mPavirv00063200mPavirv00024979m
Pavirv00056114mPavirv00010670m
Physcomitrella patensPp1s69_249V6.3Pp1s69_249V6.2Pp1s69_249V6.1Pp1s7_65V6.4Pp1s7_65V6.3
Pp1s7_65V6.2Pp1s7_65V6.1Pp1s215_17V6.1Pp1s193_42V6.1Pp1s68_64V6.1
Pp1s313_99V6.1Pp1s155_50V6.3Pp1s155_50V6.2Pp1s155_50V6.1
Phaseolus vulgarisPhvul.005G001100.1Phvul.006G118500.1Phvul.002G243500.1Phvul.003G114800.1Phvul.006G169100.1
Phvul.008G044500.1Phvul.007G120000.1Phvul.004G066500.1Phvul.004G066300.1Phvul.004G066600.1
Phvul.006G107300.1Phvul.007G156000.1Phvul.006G169000.1Phvul.006G169300.1Phvul.008G268800.1
Phvul.002G022600.1Phvul.006G045800.1Phvul.008G236800.1Phvul.003G006900.1Phvul.003G037200.1
Phvul.003G189500.1Phvul.003G248600.1Phvul.009G186800.1Phvul.003G267900.1Phvul.002G165200.1
Phvul.003G007000.1Phvul.008G208100.1
Picea abiesMA_86938g0010MA_1194g0010MA_255079g0010MA_119222g0010MA_922767g0010
MA_117003g0010MA_65830g0010MA_13412g0010MA_8133894g0010MA_948664g0010
MA_72958g0010
Populus trichocarpaPotri.019G076600.1Potri.013G102500.1Potri.019G067600.1Potri.011G076500.1Potri.004G064500.1
Potri.011G089700.1Potri.011G089700.5Potri.011G089700.2Potri.019G024700.1Potri.019G024800.1
Potri.019G024600.1Potri.018G008100.1Potri.002G253400.1Potri.013G051100.3Potri.013G051100.2
Potri.013G051100.1Potri.017G130100.1Potri.008G104600.2Potri.008G104600.1Potri.008G104700.1
Potri.012G068700.1Potri.008G104700.2Potri.012G068700.2Potri.007G036300.1Potri.011G089700.3
Potri.011G089700.4Potri.019G024800.3Potri.019G024800.2Potri.003G141300.1Potri.004G086700.1
Potri.013G115900.1Potri.004G112700.1Potri.010G137100.1Potri.T033400.1
Prunus persicappa007324mppa008473mppa007546mppa024746mppa007427m
ppb006257mppa019377mppa018058mppa020979mppa025674m
ppa021904mppa017940mppa021185mppa007718mppa009815m
ppa016932mppa026945mppa015171mppa015053mppa007092m
Ricinus communis29634.m00216629907.m00065129907.m00065230064.m00048730204.m001822
29680.m00173929680.m00173830026.m00150429680.m00174029790.m000852
30064.m00048929889.m00330629005.m00025930169.m00626057960.m000015
30026.m00150629983.m00329429929.m00452430138.m00406729683.m000474
29676.m00166929889.m00330430190.m01085244916.m00001429717.m000225
30026.m001505
Setaria italicaSi022329mSi022418mSi001771mSi017576mSi036305m
Si017558mSi010425mSi038776mSi036317mSi008290m
Si006769mSi036397mSi017786mSi006634mSi030233m
Si019579mSi019557mSi006783mSi036266mSi008557m
Si019091mSi038702mSi007988mSi014489m
Selaginella moellendorffii10025723242212893389823174517
73430806808018985364403122
80725232013985427765798492
7744011819846218267148408654
2415211538811629140259880714
Sorghum bicolorSb09g020670.1Sb01g020000.1Sb07g001270.1Sb03g033460.1Sb03g034560.1
Sb09g025780.1Sb04g026060.2Sb04g037130.1Sb04g026060.1Sb06g021990.1
Sb06g026120.1Sb04g032260.2Sb04g032260.1Sb04g028830.1Sb10g008190.1
Sb01g037330.1Sb02g042280.1Sb10g009310.1Sb04g011320.1Sb03g026750.1
Sb10g030540.1Sb01g015890.1Sb10g030530.1Sb10g022150.1
Thellungiella halophilaThhalv10015627mThhalv10007976mThhalv10000937mThhalv10007994mThhalv10027022m
Thhalv10003456mThhalv10028704mThhalv10027814mThhalv10018743mThhalv10019478m
Thhalv10000195mThhalv10010459mThhalv10008016mThhalv10022511mThhalv10025529m
Thhalv10022766mThhalv10015846mThhalv10022764mThhalv10008394mThhalv10005315m
Vitis viniferaGSVIVT01025914001GSVIVT01036522001GSVIVT01037131001GSVIVT01018171001GSVIVT01037673001
GSVIVT01021309001GSVIVT01026341001GSVIVT01026343001GSVIVT01026348001GSVIVT01028485001
GSVIVT01018115001.32.342GSVIVT01018115001.32.342GSVIVT01000246001GSVIVT01036818001GSVIVT01018115001.398.707
GSVIVT01018115001.398.707GSVIVT01034983001GSVIVT01007995001GSVIVT01019662001GSVIVT01005081001
GSVIVT01030799001GSVIVT01023901001GSVIVT01018116001GSVIVT01019553001GSVIVT01036525001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)