y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G221200.2
FamilyGH116
Protein PropertiesLength: 917 Molecular Weight: 102605 Isoelectric Point: 6.6044
ChromosomeChromosome/Scaffold: 06 Start: 47396986 End: 47406251
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1164988600
  GRFLYLEGVEYIMWNTYDVHFYASFALLDLFPKIELNIQRDFAKAVLSEDGRRVKFLAEGNYGIRKVRGAVPHDLGTHDPWNEMNAYNIHDTSKWKDLNP
  KFVLQVYRDFAATGDMQFGVDVWPAVRTAMEYMEQFDRDDDGLIENDGFPDQTYDAWTVHGVSAYCGCLWLAALQAAAAMAEQIGDRFFAETCKTKFCTA
  KSAFEKKLWNGSYFKYDSGSSSNSKSIQADQLAGQWYTASSGLAPLFDEFKIRSALQKIYDFNVMKVKGGRMGAVNGMHLNGKVDETCMQSREIWTGVTY
  AVAANMILAGMEKEAFATAEGIFIAGWSEEGFGYWFQTPEAWTMDGHFRSLIYMRPLAIWGMQ
Full Sequence
Protein Sequence     Length: 917     Download
MAGKHLLTLS PVKVASHLHL KEFHWEEWGI YVVQLNGLVC TAGRFYASDC GNLCCRSGSI    60
SRGFRGEFRQ WQIVPGTCDS SPVMANQFSI FVSRDSGNKK YASVLAPGRH EGLGKARDEG    120
ISSWGWNLSG QHSTYHALFP RAWTIYDGEP DPELKVSCRQ ISPFIPHNYK DTSLPTAVFV    180
YTLVNTGRER AKVSLLFTWA NSIGGVSHLS GDHVNEPFIG EDGVSGVLLH HKTAKGNPPV    240
TFAIAACETQ NVNVTVLPCF GLTEGRSVTA RQMWDKMMQD GQFDRQNFNS GPSMPSSPGE    300
TLCAAVSASA WVEPHGKCTI AFSLAWSSPK IKFLKGSSYH RRYTKFYGTS ERAALNLAHD    360
ALTNYKRWEE EIEKWQSPIL NDQRLPEWYK FTLFNELYFL VAGGTVWIDS SLPSTNVKND    420
QDSPEDAQRV DVKVTEAEVN RRHTTISEYS TTSGCNGSTG DVLKNNSDPA VTQNKRNSNN    480
LSEHFKWQDQ LDDYDDVGRF LYLEGVEYIM WNTYDVHFYA SFALLDLFPK IELNIQRDFA    540
KAVLSEDGRR VKFLAEGNYG IRKVRGAVPH DLGTHDPWNE MNAYNIHDTS KWKDLNPKFV    600
LQVYRDFAAT GDMQFGVDVW PAVRTAMEYM EQFDRDDDGL IENDGFPDQT YDAWTVHGVS    660
AYCGCLWLAA LQAAAAMAEQ IGDRFFAETC KTKFCTAKSA FEKKLWNGSY FKYDSGSSSN    720
SKSIQADQLA GQWYTASSGL APLFDEFKIR SALQKIYDFN VMKVKGGRMG AVNGMHLNGK    780
VDETCMQSRE IWTGVTYAVA ANMILAGMEK EAFATAEGIF IAGWSEEGFG YWFQTPEAWT    840
MDGHFRSLIY MRPLAIWGMQ WALSIPKAIL DAPKVNMMDK ILISPATFSL SLTETGVRKI    900
ANKAKCFGNS VLHCAC*                                                   960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB10.002565655100+
COG4354COG43541.0e-2560409352+
pfam12215GBA2_N2.0e-6157368325+
COG4354COG43545.0e-64495863387+
pfam04685DUF6081.0e-148498861367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB01359.1057916110937unnamed protein product [Arabidopsis thaliana]
RefSeqNP_189060.2057916110950catalytic/ glucosylceramidase [Arabidopsis thaliana]
RefSeqXP_002285674.1057916110978PREDICTED: similar to catalytic [Vitis vinifera]
RefSeqXP_002303825.1057916110966predicted protein [Populus trichocarpa]
RefSeqXP_002518119.1057916110968conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7798602796409170
HO7798601504926410
HO779860983634600
GT045437317643800
GT045437293764040.0001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.1
Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)