y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G224700.1
FamilyCBM43
Protein PropertiesLength: 463 Molecular Weight: 50650 Isoelectric Point: 7.4932
ChromosomeChromosome/Scaffold: 06 Start: 47629341 End: 47631194
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433734561.3e-23
  WCEVAPWVNEMSLPAALSNVCSIDNETCAALAPGKDCYEPVSVVWHASYAFSSYWAKFRSQGAICSFNGLARETTVDPSRGRCN
GH17233460
  IGVNYGREGDNLPSPYESIQIMKSIKVGQIKLNDSNPEILTLLSGTKIHVAVTVPNDDIIQIGSNDSMAEQWVRNNILPHYPDTMIRFVLVGDRVVNSNM
  DVNGTMEQSLVPAMRGIKSALTAHGVKNVKVSTTLGMDVVQTRFPPSNSTFQSDISDSVMPKLLKFVNGTKSVVFVDVYPYFAWSANPTNISLDFALFGG
  NITHTDPGSGLVYTNLLDQMLDSVTFAIEKLGFRNIRLAISRTGWPTAGDIDQVGANIYNAATYNRNLIRKMTSKQPLGSPKSPGLIIPTFISSLYDENR
  KIGPETERHWGMLHTNGTPVYEID
Full Sequence
Protein Sequence     Length: 463     Download
MALLPLLFSS LLVVSLAEMS GKIGVNYGRE GDNLPSPYES IQIMKSIKVG QIKLNDSNPE    60
ILTLLSGTKI HVAVTVPNDD IIQIGSNDSM AEQWVRNNIL PHYPDTMIRF VLVGDRVVNS    120
NMDVNGTMEQ SLVPAMRGIK SALTAHGVKN VKVSTTLGMD VVQTRFPPSN STFQSDISDS    180
VMPKLLKFVN GTKSVVFVDV YPYFAWSANP TNISLDFALF GGNITHTDPG SGLVYTNLLD    240
QMLDSVTFAI EKLGFRNIRL AISRTGWPTA GDIDQVGANI YNAATYNRNL IRKMTSKQPL    300
GSPKSPGLII PTFISSLYDE NRKIGPETER HWGMLHTNGT PVYEIDLTGN RKISEYKPLP    360
PAVNNVPYKG KLWCEVAPWV NEMSLPAALS NVCSIDNETC AALAPGKDCY EPVSVVWHAS    420
YAFSSYWAKF RSQGAICSFN GLARETTVDP SRGRCNFPSV TV*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X88.0e-1337244381+
smart00768X82.0e-2737245786+
pfam00332Glyco_hydro_173.0e-10523346325+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM64490.101946233476beta-1,3-glucanase, putative [Arabidopsis thaliana]
EMBLCAA49513.101546230474beta-1,3-glucanase homologue [Brassica napus]
EMBLCBI39470.10646212467unnamed protein product [Vitis vinifera]
RefSeqNP_193144.101546234478MEE48 (maternal effect embryo arrest 48); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqXP_002298669.1074627462predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0233471312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B0233471306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0233471306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3f55_D0223481316A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3f55_C0223481316A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Signal Peptide
Cleavage Site
17
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG453718205172200
EX0509562941694620
EX0515792881764630
DT7372832711964630
DR9441182731063770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)