y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G228500.1
FamilyGT1
Protein PropertiesLength: 406 Molecular Weight: 44760.7 Isoelectric Point: 6.391
ChromosomeChromosome/Scaffold: 06 Start: 47931452 End: 47933181
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12043401.3e-26
  DKSVVYVAFGTQITLTKQQMEAVASALEESMVRFIWVVKEPMKGLGIVDDDDRNVVPPGFEDRVAERGVVIKGWAPQLAILGHPAVGSYLTHCGWNSALE
  GIFAGVLLLAWPMQADHFHNTALLVDELGVAVRVCEG
Full Sequence
Protein Sequence     Length: 406     Download
MTNFSNGVHV LMIPFPASGH IFPLMDLAHQ ILLRGLTVTI MVTPKNLHYL NSLLSLHSSS    60
NLQTLVLPFP SHSSIPHGVE NMQDVDISFV PDFAAALTSR LGVPNVCFVV TNAHAVSSWW    120
VNDLDSMPDC YRKLHLGCIQ SWALVFNSFN EIDNQKLKLI KEELTEHDRL WAVGPLLPIK    180
GRLSSIGEEQ YQVMSWLDSC KKVDKSVVYV AFGTQITLTK QQMEAVASAL EESMVRFIWV    240
VKEPMKGLGI VDDDDRNVVP PGFEDRVAER GVVIKGWAPQ LAILGHPAVG SYLTHCGWNS    300
ALEGIFAGVL LLAWPMQADH FHNTALLVDE LGVAVRVCEG LETVPDASKL ARTLSGSLTM    360
NMPERIRTKK LRKTAVDSIR EGGSSYKALD GLVEQLSSLS NREEK*                   420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03007PLN030070.000784437+
PLN02992PLN029921.0e-43170389235+
PLN03004PLN030041.0e-44140388253+
PLN03007PLN030072.0e-49139398276+
PLN02863PLN028638.0e-1343399478+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG52529.1033968466AC016662_23 putative glucosyltransferase; 88035-86003 [Arabidopsis thaliana]
GenBankAAM60911.1023963433unknown [Arabidopsis thaliana]
DDBJBAE98508.1023963433hypothetical protein [Arabidopsis thaliana]
RefSeqNP_177529.2023997469UGT89B1 (UDP-GLUCOSYL TRANSFERASE 89B1); UDP-glycosyltransferase/ quercetin 3-O-glucosyltransferase/ quercetin 4'-O-glucosyltransferase/ quercetin 7-O-glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqNP_563756.1023963433UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A9.94922e-4453894460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2vch_A9.94922e-4453894460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2vce_A9.94922e-4453894460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acv_B4e-30130397201462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A4e-30130397201462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG63125648893990
EL4805272571363900
DK5424632331754030
DR9216922271744000
DT7288202211804000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi5g10710.1Bradi3g38930.1Bradi5g24280.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04524.1-v1.0-hybridmrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1Glyma06g22820.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G185000.1Gorai.012G184900.1Gorai.008G174800.1
Gorai.012G185100.1Gorai.003G103500.1Gorai.006G228600.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563MDP0000234849
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17250.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)