y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G228600.1
FamilyGT1
Protein PropertiesLength: 458 Molecular Weight: 50280.6 Isoelectric Point: 8.4004
ChromosomeChromosome/Scaffold: 06 Start: 47935765 End: 47937385
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11573812e-25
  FWISTPSFLLPFYREAFTMSMQSEGLVFNSFKELESTKLGLIKEKFAKHCRVWGVGPLPPVKVGDEGLNERGGATSIPPDQVISWLDSCKVDKSVVYIGF
  GTQITLTKHQMKAVASALEESGVRFIWAVKEPMKRAEDGDDDQSLIPHGFEDRVKGQGLVIKGWVPQLTILKHRAVGSYFTHCGWNSALEAIVAGVLLLA
  WPMQADHFQITRLLADEVGAAIRVC
Full Sequence
Protein Sequence     Length: 458     Download
MSEVKYSGTG AGGGHICIIP FPACGHILPL MDLTHQLLLR GLTVTIMVTP KNLSYLNPLL    60
ALHSPNVKPL VFPFPSHPSL PHGVEQMQDL PISFLPHIVN ALGKLYHPLV QWFRAQQSPP    120
VAILSDIVLS SWTVNLASHL NIPNICFVPF NVAAVYFWIS TPSFLLPFYR EAFTMSMQSE    180
GLVFNSFKEL ESTKLGLIKE KFAKHCRVWG VGPLPPVKVG DEGLNERGGA TSIPPDQVIS    240
WLDSCKVDKS VVYIGFGTQI TLTKHQMKAV ASALEESGVR FIWAVKEPMK RAEDGDDDQS    300
LIPHGFEDRV KGQGLVIKGW VPQLTILKHR AVGSYFTHCG WNSALEAIVA GVLLLAWPMQ    360
ADHFQITRLL ADEVGAAIRV CKGLRSVPDA TKLARIFVES TTVGQPQRVR AMELQKTALN    420
AIKEGGSSYQ ALDKVAEELT SFGCNRTEMM KTIRSSL*                            480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02448PLN024481.0e-4315433474+
PLN02670PLN026702.0e-4415370403+
PLN02534PLN025341.0e-6015440487+
PLN03007PLN030071.0e-6515441488+
PLN02863PLN028635.0e-16913445475+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG52529.101543314460AC016662_23 putative glucosyltransferase; 88035-86003 [Arabidopsis thaliana]
GenBankAAM60911.101543910433unknown [Arabidopsis thaliana]
DDBJBAE98508.101543910433hypothetical protein [Arabidopsis thaliana]
RefSeqNP_177529.201544614473UGT89B1 (UDP-GLUCOSYL TRANSFERASE 89B1); UDP-glycosyltransferase/ quercetin 3-O-glucosyltransferase/ quercetin 4'-O-glucosyltransferase/ quercetin 7-O-glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqNP_563756.101543910433UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A5e-40154368464A Chain A, Ferric Horseradish Peroxidase C1a In Complex With Formate
PDB2vch_A5e-40154368464A Chain A, Ferric Horseradish Peroxidase C1a In Complex With Formate
PDB2vce_A5e-40154368464A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A2e-341543910477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B2e-28140440174462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG631256496154530
CK1209242302124390
DK5424632312134430
CK1217742212124300
DT7288202232254470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi5g10710.1Bradi3g38930.1Bradi5g24280.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04524.1-v1.0-hybridmrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1Glyma06g22820.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G185000.1Gorai.012G184900.1Gorai.008G174800.1
Gorai.012G185100.1Gorai.003G103500.1Gorai.006G228500.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563MDP0000234849
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17250.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)