y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G229700.1
FamilyGT57
Protein PropertiesLength: 541 Molecular Weight: 61901.3 Isoelectric Point: 9.6542
ChromosomeChromosome/Scaffold: 06 Start: 47996727 End: 48000765
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57465190
  LLVRVAVGLHPYSGARTPPKFGDYEAQRHWMEITLNLPPKDWYRNSSVNDLSYWGLDYPPLTAYQSYVHGVFLKTFDPDSVALFTSRGYESYLGKLLMRW
  TVLSSDVLIFFPAVLYFVLVYRSMRFGMGQNSDVAWHIAMILLNPCLILIDHGHFQYNCISLGLTIAAIAAALSQKDLVASVLYCLALNHKQMSAYFAPA
  FFGYLLGKCLRKKNPLLEVTKLGLMVIGTFAVVWWPYLQSKDAALAVLSRLAPFERGIYEDYVANFWCTSSVLVKWKKLYSTQSLRIFSLAATLITCLPS
  MVQQILAPSSKGFLYALLNTSFSFYLFSFQVHEKSILLPLLPLTLLALEESRSILWLTHFAMFSMFPLLHRDKLVLAYMALYALFILVYFAPCGPSGRCH
  GTKTLDNTQKTKRSVDFITSITFHPLLMGFLGLCSLILHVIYLTMHPPNKYPFLFEAVIMLICFSQFVLFTFYF
Full Sequence
Protein Sequence     Length: 541     Download
MKKKGEMKKV KKVKDKVNDG QYDDPWWWLV QEGIRPSFLC ISLFALLVRV AVGLHPYSGA    60
RTPPKFGDYE AQRHWMEITL NLPPKDWYRN SSVNDLSYWG LDYPPLTAYQ SYVHGVFLKT    120
FDPDSVALFT SRGYESYLGK LLMRWTVLSS DVLIFFPAVL YFVLVYRSMR FGMGQNSDVA    180
WHIAMILLNP CLILIDHGHF QYNCISLGLT IAAIAAALSQ KDLVASVLYC LALNHKQMSA    240
YFAPAFFGYL LGKCLRKKNP LLEVTKLGLM VIGTFAVVWW PYLQSKDAAL AVLSRLAPFE    300
RGIYEDYVAN FWCTSSVLVK WKKLYSTQSL RIFSLAATLI TCLPSMVQQI LAPSSKGFLY    360
ALLNTSFSFY LFSFQVHEKS ILLPLLPLTL LALEESRSIL WLTHFAMFSM FPLLHRDKLV    420
LAYMALYALF ILVYFAPCGP SGRCHGTKTL DNTQKTKRSV DFITSITFHP LLMGFLGLCS    480
LILHVIYLTM HPPNKYPFLF EAVIMLICFS QFVLFTFYFN SKQWMLSKHL TSKDKQKKLI    540
*                                                                    600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5650COG56500.00245283241+
pfam03155Alg6_Alg83.0e-11645520484+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001145139.103653931519hypothetical protein LOC100278369 [Zea mays]
RefSeqNP_198662.1025408533ALG6, ALG8 glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002280181.10115407516PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305159.104953915490predicted protein [Populus trichocarpa]
RefSeqXP_002329281.104953911485predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
141163
178195
202219
261283
330352
357374
381403
423445
466488
498520
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT559534277182940
DT571256239182560
ES8495902283145410
DN6203322731444160
EB680102247182640
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2AT5G38460.1
Brachypodium distachyonBradi1g63540.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Citrus sinensisorange1.1g021456m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Fragaria vescamrna11817.1-v1.0-hybrid
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.2
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619mcassava4.1_005541m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.004G064500.1Phvul.002G243400.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny