y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G229700.2
FamilyGT57
Protein PropertiesLength: 399 Molecular Weight: 45407.3 Isoelectric Point: 9.6881
ChromosomeChromosome/Scaffold: 06 Start: 47996871 End: 48000717
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT5713770
  MRWTVLSSDVLIFFPAVLYFVLVYRSMRFGMGQNSDVAWHIAMILLNPCLILIDHGHFQYNCISLGLTIAAIAAALSQKDLVASVLYCLALNHKQMSAYF
  APAFFGYLLGKCLRKKNPLLEVTKLGLMVIGTFAVVWWPYLQSKDAALAVLSRLAPFERGIYEDYVANFWCTSSVLVKWKKLYSTQSLRIFSLAATLITC
  LPSMVQQILAPSSKGFLYALLNTSFSFYLFSFQVHEKSILLPLLPLTLLALEESRSILWLTHFAMFSMFPLLHRDKLVLAYMALYALFILVYFAPCGPSG
  RCHGTKTLDNTQKTKRSVDFITSITFHPLLMGFLGLCSLILHVIYLTMHPPNKYPFLFEAVIMLICFSQFVLFTFYF
Full Sequence
Protein Sequence     Length: 399     Download
MRWTVLSSDV LIFFPAVLYF VLVYRSMRFG MGQNSDVAWH IAMILLNPCL ILIDHGHFQY    60
NCISLGLTIA AIAAALSQKD LVASVLYCLA LNHKQMSAYF APAFFGYLLG KCLRKKNPLL    120
EVTKLGLMVI GTFAVVWWPY LQSKDAALAV LSRLAPFERG IYEDYVANFW CTSSVLVKWK    180
KLYSTQSLRI FSLAATLITC LPSMVQQILA PSSKGFLYAL LNTSFSFYLF SFQVHEKSIL    240
LPLLPLTLLA LEESRSILWL THFAMFSMFP LLHRDKLVLA YMALYALFIL VYFAPCGPSG    300
RCHGTKTLDN TQKTKRSVDF ITSITFHPLL MGFLGLCSLI LHVIYLTMHP PNKYPFLFEA    360
VIMLICFSQF VLFTFYFNSK QWMLSKHLTS KDKQKKLI*                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg85.0e-741378385+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001145139.101397138519hypothetical protein LOC100278369 [Zea mays]
RefSeqNP_198662.101398147533ALG6, ALG8 glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002280181.101398138516PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305159.101397109490predicted protein [Populus trichocarpa]
RefSeqXP_002329281.101397105485predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
524
3759
6991
188210
215232
239261
281303
324346
356378
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8495902281723990
DN62033227322740
EC986613317833990
DN960234263503120
GE608284261453010
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2AT5G38460.1
Brachypodium distachyonBradi1g63540.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Citrus sinensisorange1.1g021456m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Fragaria vescamrna11817.1-v1.0-hybrid
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.1
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619mcassava4.1_005541m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.004G064500.1Phvul.002G243400.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny