y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G234200.1
FamilyAA2
Protein PropertiesLength: 486 Molecular Weight: 53535.7 Isoelectric Point: 8.4946
ChromosomeChromosome/Scaffold: 06 Start: 48245753 End: 48252069
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA23064681.5e-35
  HREPRMGASLLRLHFHDCFVNVTSILHTTILCMPYNDLDELIFFVFQGCDGSLLLDSTSAFETEKNARGNFNSVRGFEVVDQIKAEVDRVCGRPVVSCAD
  ILAVAARDSVLALGGPTWKVRLGRRDSTTASRTLADSLLPSASMDLPALINNFKNQGLNKRDL
AA2502430
  REPRMGASLLRLHFHDCFVNVTSILHTTILCMPYNDLDELIFFVFQGCDGSLLLDSTSAFETEKNARGNFNSVRGFEVVDQIKAEVDRVCGRPVVSCADI
  LAVAARDSVLALGGPTWKVRLGRRDSTTASRTLADSLLPSASMDLPALINNFKNQGLNKRDLVALSGGHTIGLSQCVIFRNRIYNATNIDPAFA
Full Sequence
Protein Sequence     Length: 486     Download
MAPRFNFLLH AFLCLALATT SFSLSPKFYD NLCPQALPAI KRIVEAAVHR EPRMGASLLR    60
LHFHDCFVNV TSILHTTILC MPYNDLDELI FFVFQGCDGS LLLDSTSAFE TEKNARGNFN    120
SVRGFEVVDQ IKAEVDRVCG RPVVSCADIL AVAARDSVLA LGGPTWKVRL GRRDSTTASR    180
TLADSLLPSA SMDLPALINN FKNQGLNKRD LVALSGGHTI GLSQCVIFRN RIYNATNIDP    240
AFAKERRATC PRTGGNTNLA PFDPTPARFD TAYFKNLVKE RGLLTSDQAL FSALPAIKRI    300
VEAAVHREPR MGASLLRLHF HDCFVNVTSI LHTTILCMPY NDLDELIFFV FQGCDGSLLL    360
DSTSAFETEK NARGNFNSVR GFEVVDQIKA EVDRVCGRPV VSCADILAVA ARDSVLALGG    420
PTWKVRLGRR DSTTASRTLA DSLLPSASMD LPALINNFKN QGLNKRDLCS SLRWPHHRIV    480
TMRYL*                                                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase3.0e-48297468172+
PLN03030PLN030301.0e-5228292274+
pfam00141peroxidase6.0e-5640222183+
cd00693secretory_peroxidase1.0e-62297468172+
cd00693secretory_peroxidase9.0e-11724303288+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002268412.1012931269PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268412.1029346838187PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323055.10242931244predicted protein [Populus trichocarpa]
RefSeqXP_002531319.1012911269Peroxidase 2 precursor, putative [Ricinus communis]
RefSeqXP_002531319.1028746833188Peroxidase 2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0243012253A Chain A, Peanut Peroxidase
PDB1sch_B029246813162A Chain A, Peanut Peroxidase
PDB1sch_A0243012253A Chain A, Peanut Peroxidase
PDB1sch_A029246813162A Chain A, Peanut Peroxidase
PDB7atj_A0243002260A Chain A, Peanut Peroxidase
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG688130269242910
EG6881301822874680
EG669469266242880
EG6694691842874700
CK936198275202930
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00293.1
Brachypodium distachyonBradi3g20130.1
Brassica rapaBra026822Bra009105
Carica papayaevm.TU.contig_36992.1evm.model.supercontig_2.328
Citrus sinensisorange1.1g039303morange1.1g048203m
Glycine maxGlyma02g42751.1
Gossypium raimondiiGorai.006G234200.1.306.468Gorai.N001300.1Gorai.006G234200.1.50.243Gorai.006G234200.1.50.243Gorai.006G234200.1.306.468
Linum usitatissimumLus10034204Lus10029065Lus10030149Lus10006535Lus10009934
Lus10009090
Malus domesticaMDP0000198792MDP0000609381MDP0000743939
Manihot esculentacassava4.1_026723m
Medicago truncatulaMedtr5g074860.2
Mimulus guttatusmgv1a013189m
Oryza sativaLOC_Os03g22010.4
Panicum virgatumPavirv00015681mPavirv00067606mPavirv00057248mPavirv00065225mPavirv00057416m
Pavirv00052889mPavirv00058505mPavirv00047210mPavirv00054393m
Phaseolus vulgarisPhvul.008G086900.1
Picea abiesMA_10437025g0010MA_73697g0020MA_10427367g0010MA_188220g0010MA_9438531g0010
MA_10434028g0030MA_49450g0010MA_10436483g0010.311.488MA_10436483g0010.311.488MA_10430775g0010
MA_9573747g0010MA_38027g0010MA_185755g0010MA_195910g0010MA_425572g0010
MA_6833274g0010MA_90g0010MA_493312g0010MA_190625g0010MA_792979g0010
MA_9984688g0010MA_96757g0010MA_720299g0010
Populus trichocarpaPotri.013G083600.2
Prunus persicappa017309mppa020242m
Setaria italicaSi015307m
Selaginella moellendorffii9205428740
Sorghum bicolorSb04g008600.1Sb01g036000.1
Vitis viniferaGSVIVT01010261001GSVIVT01030219001.289.404GSVIVT01030219001.289.404GSVIVT01025365001GSVIVT01032715001
GSVIVT01024599001GSVIVT01009777001GSVIVT01010266001GSVIVT01020738001GSVIVT01009108001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny