y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G236100.2
FamilyGT8
Protein PropertiesLength: 610 Molecular Weight: 68897.9 Isoelectric Point: 9.1834
ChromosomeChromosome/Scaffold: 06 Start: 48377701 End: 48383955
Descriptiongalacturonosyltransferase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT82855810
  CLSMRLTVEYFRDDSFDQELPVKYSDPTLQHYVIFSTNVIASTVVINSTVMHARDSMNQVFHVLTNGQNYYAMKHWFLGNTFKDAVVEVLNIDPFIPDYY
  DKATPSHLNLPTEFRVSFHGINNASAMHSRTQYISIFSHSHYLLPEIFKNLEKVVVLDDDIVVQQDLSTLWSLNMGQKVMGAIQICSVRLGQVRSYLGES
  SFHKNSCTWMSGLNVIDLARWRKLGISETYWKLVKEQVSKKEGSAALASLLTFQDLIYALDNDWVLSGLGHDYGLSTQSIKKAAVLHYNGNMKPWLE
Full Sequence
Protein Sequence     Length: 610     Download
MKGGGGGGGV GPGKRRWRFL AVGVLFLVVL SMLVPLGFLL GLHNGFHSAG FVPRPHTTTS    60
GDRSNHVDNL VRKLGPTLPK DILKHYVNEA KNETSSANAT RKSQKKKGTP VPPQVVLQPL    120
SKRNISGDGD KAGMKGGINE GLRLCELQYG SYCIWHEENR EDMKDSMVKK LKDQLFVARA    180
YYPSVAKIPA QNTLTRDLRQ NIQELERVLS ESTTDADLPP EIQKKSERME ATIAKSKSVT    240
MDCHNVDKKL RQIFDLTEDE ANFHMKQSAF LYQLAVQTMP KSQHCLSMRL TVEYFRDDSF    300
DQELPVKYSD PTLQHYVIFS TNVIASTVVI NSTVMHARDS MNQVFHVLTN GQNYYAMKHW    360
FLGNTFKDAV VEVLNIDPFI PDYYDKATPS HLNLPTEFRV SFHGINNASA MHSRTQYISI    420
FSHSHYLLPE IFKNLEKVVV LDDDIVVQQD LSTLWSLNMG QKVMGAIQIC SVRLGQVRSY    480
LGESSFHKNS CTWMSGLNVI DLARWRKLGI SETYWKLVKE QVSKKEGSAA LASLLTFQDL    540
IYALDNDWVL SGLGHDYGLS TQSIKKAAVL HYNGNMKPWL ELGIPKYKVY WRKFLNPENQ    600
FLNECNVNP*                                                           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06429GT8_like_11.0e-78315596286+
PLN02718PLN027183.0e-93165607468+
PLN02910PLN029104.0e-101150608491+
PLN02829PLN028299.0e-111163609464+
PLN02769PLN02769014608618+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_565893.104460945619GAUT7 (GALACTURONOSYLTRANSFERASE 7); polygalacturonate 4-alpha-galacturonosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002264525.104460948613PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323701.10145609151620glycosyltransferase, CAZy family GT8 [Populus trichocarpa]
RefSeqXP_002326255.10145609121590glycosyltransferase [Populus trichocarpa]
RefSeqXP_002519984.10138608100575Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.00000241657977252A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1g9r_A0.00000241657977252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.0000241657977252A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB1bax_A0.0094865263794A Chain A, Mason-Pfizer Monkey Virus Matrix Protein, Nmr, Average Structure
PDB2f76_X0.014865263794X Chain X, Solution Structure Of The M-Pmv Wild Type Matrix Protein (P10)
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0810832722585290
EX2882353341735040
EE6085002751454190
EE6103532761474220
HO7854493152936010
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma16g09405.1Glyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.3
Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)