y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G245500.1
FamilyCE10
Protein PropertiesLength: 831 Molecular Weight: 90686.5 Isoelectric Point: 6.8072
ChromosomeChromosome/Scaffold: 06 Start: 49047666 End: 49055079
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105928134.1e-30
  NNAPDPLIVVLHGGPHSVSLSSFSKSLAFLSSLGFSLLIVNYRGSLGFGEEALQSLPGKIGSQDVNDVLTAIDHVIEKGLVNPSKITVLGGSHGGFLTTH
  LIGQAPDKFVAAAARNPVCNLSSMVATTDIPDWCYVESYGSKGKTIFTEAPSAEHLTHFYSKSPILHISKVKAPTIFLLGAQDLRVPVSGGLQYARALKE
  RGVETKIILFPNDIHAIERPQS
Full Sequence
Protein Sequence     Length: 831     Download
MSRTLPLAYF TSISSNISTW SGTLAASPRF SLLFFSSQPR LSLFSSTPIS HYVKNLPAIL    60
AMDSSKAGTV KELPVGLDEA TEEEYASQSK LLQEFTNISS IDKAWVFKSE SGICSQAMFL    120
ISQPNLLANK KRKFMLSTSI SKESNNNVNF QWAPFPVEMT GVSITVPSPS GSKLLVIRNP    180
ENESPTQFEI WSSSRLEKEF RIPQSTHGSV YADGWFEGIS WNSDESLIAY VAEEPSPCKP    240
SFDCQGYKQG AAKDKECMSW KGQGDWEEEW GECYAGKRQP ALFVINLNSG KVHAVKGIAK    300
SLSVGQVVWA PPVESIDQYL VFVGWSADPR KLGIKYCYNR PCALYAVKVP LYKSEAAQSD    360
LKSMEELTVV NLTQSISSAF FPQFSPDGKF IVFLSAKASV DSGVHSATDS LHRIDWPTDG    420
KLCSSTKIID VIPVVNCAED GQFPGLYCSS FLSKPWLSDG CTMILSSYWR SCQVILSVNV    480
LSGEVLRIST ADSGFSWNVL TLDGDNIIAV CSSPIDVPQI KYGCLEDKAT NTTAWHWLNV    540
SSPIFKCSEK VTSLLSHLQF GITQIPVKDV SDCLTKGAAK SFEAIFVSSK VNNAPDPLIV    600
VLHGGPHSVS LSSFSKSLAF LSSLGFSLLI VNYRGSLGFG EEALQSLPGK IGSQDVNDVL    660
TAIDHVIEKG LVNPSKITVL GGSHGGFLTT HLIGQAPDKF VAAAARNPVC NLSSMVATTD    720
IPDWCYVESY GSKGKTIFTE APSAEHLTHF YSKSPILHIS KVKAPTIFLL GAQDLRVPVS    780
GGLQYARALK ERGVETKIIL FPNDIHAIER PQSDFESFLN IGVWFKKYCK *             840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes2.0e-5585826255+
pfam12697Abhydrolase_61.0e-5599799201+
COG1505COG15051.0e-7632796169+
pfam00326Peptidase_S91.0e-29630828202+
COG1506DAP23.0e-36597830234+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26348.10238308822unnamed protein product [Vitis vinifera]
RefSeqNP_193193.20628301763acylaminoacyl-peptidase-related [Arabidopsis thaliana]
RefSeqXP_002284013.10628301770PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002284016.10628301760PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002517031.10628301771acylamino-acid-releasing enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B5e-18597807379579B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB4hxe_B5e-18597807379579B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L1e-17597807379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K1e-17597807379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J1e-17597807379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO1252972914847740
DW49532627722780
DW49532727222730
ES8436052425908310
GO8504863424868270
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)