y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G260600.1
FamilyCE8
Protein PropertiesLength: 564 Molecular Weight: 61779.6 Isoelectric Point: 5.9386
ChromosomeChromosome/Scaffold: 06 Start: 50124388 End: 50126586
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82475420
  DVVVAKDGSGKYDTITKALEEVPKKSPNRFVIHIKAGIYKEKINVTKQMTNVMFIGDGPTKTIITNDINCINNHPLKTFQTATVGVDGVGFMAKDIGFEN
  TAGPEGHQAVAFRATSNKVIMFNCHFTGYQDTLYPHKGQQFYRDCVISGTVDFIFGDSASVFQNCLIIVRKPGENQNNMITAPGRQYIDTDSALVLQNCT
  ITGAPDYLPVKDKSKTYLGRPWKPLARAIIMQSTIEDIITPEGYAPMEGTKGLDTAYFAEFENKGPGAKTEGRVTWPAIKKIDINEAKKWTPGVFL
Full Sequence
Protein Sequence     Length: 564     Download
MANNVAVIGI CSVFLVAVVV AVVVGVSQTH TKEESDSKSN SISSSNKAVQ AVCQPTHFKD    60
ACEKSLASSN STDTKELIRS SFQAAIEEVR KVLANSTTIQ DLNKDDNNRE ALKVCQEVLD    120
LSIDDLQLSF DKMGEYDMSK IGDYLLNLRV WLSGALTTQQ TCVDTFAEVS NEQAEKMKLV    180
LKTSMELTAN ALTMVTKLST VLKDLNIPGL DGIDTTGFER KLLSNDGPEW MGHAERKLLQ    240
APIIKPDVVV AKDGSGKYDT ITKALEEVPK KSPNRFVIHI KAGIYKEKIN VTKQMTNVMF    300
IGDGPTKTII TNDINCINNH PLKTFQTATV GVDGVGFMAK DIGFENTAGP EGHQAVAFRA    360
TSNKVIMFNC HFTGYQDTLY PHKGQQFYRD CVISGTVDFI FGDSASVFQN CLIIVRKPGE    420
NQNNMITAPG RQYIDTDSAL VLQNCTITGA PDYLPVKDKS KTYLGRPWKP LARAIIMQST    480
IEDIITPEGY APMEGTKGLD TAYFAEFENK GPGAKTEGRV TWPAIKKIDI NEAKKWTPGV    540
FLGSDQWVPQ AGIPYYPDMV PVV*                                           600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02314PLN023147.0e-14449555530+
pfam01095Pectinesterase7.0e-155247545300+
PLN02745PLN027453.0e-15548554525+
PLN02217PLN022179.0e-17248559516+
PLN02990PLN029901.0e-1737555556+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI22967.104256340546unnamed protein product [Vitis vinifera]
EMBLCBI39537.103655546570unnamed protein product [Vitis vinifera]
RefSeqXP_002279123.103655546570PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002314364.103156043569predicted protein [Populus trichocarpa]
RefSeqXP_002516960.103956258579Pectinesterase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02405551315A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02445551311B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B1e-202475495339A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A1e-202475495339A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B2e-202475495339A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO1215252872255110
CO128390283873690
CO1201782692234910
CO1201772273385640
CO1096282481463930
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_019_00179.1Aquca_017_00134.1Aquca_017_00135.1Aquca_020_00598.1Aquca_012_00160.1
Aquca_035_00109.1Aquca_035_00108.1Aquca_029_00052.1
Arabidopsis lyrata477851910790494979478002859154
320434353497486726483877
Arabidopsis thalianaAT3G05610.1AT5G27870.1AT5G49180.1AT3G06830.1AT4G15980.1
AT4G33230.1AT2G26450.1AT2G47030.1AT2G47040.1AT3G62170.1
Brachypodium distachyonBradi5g23550.1Bradi4g30980.1Bradi1g64860.1Bradi5g12300.1Bradi1g16780.1
Bradi1g60380.1
Brassica rapaBra039421Bra036610Bra009938Bra040293Bra040532
Bra029607Bra020658Bra038049Bra001219Bra000541
Bra001157Bra037013Bra004481Bra000438Bra040474
Bra007665Bra014410Bra003491
Carica papayaevm.model.supercontig_50.162evm.model.supercontig_48.111evm.model.supercontig_82.46evm.model.supercontig_146.24evm.model.supercontig_41.94
Capsella rubellaCarubv10015948mCarubv10003818mCarubv10027546mCarubv10015933mCarubv10007222m
Carubv10024513mCarubv10006885mCarubv10024512mCarubv10025567mCarubv10019418m
Citrus clementinaCiclev10000446mCiclev10000436mCiclev10000435mCiclev10000415mCiclev10007819m
Ciclev10010665m
Citrus sinensisorange1.1g039111morange1.1g035494m
Cucumis sativusCucsa.159100.1Cucsa.181720.1Cucsa.252880.1Cucsa.069220.1Cucsa.374170.1
Cucsa.374150.1Cucsa.374190.1
Fragaria vescamrna22811.1-v1.0-hybridmrna07045.1-v1.0-hybridmrna07046.1-v1.0-hybridmrna07048.1-v1.0-hybridmrna12964.1-v1.0-hybrid
mrna24568.1-v1.0-hybrid
Glycine maxGlyma15g20460.1Glyma09g08910.2Glyma02g01140.1Glyma10g01180.1Glyma0248s00220.1
Glyma07g02790.1Glyma07g02780.1Glyma07g03010.1Glyma07g02750.1Glyma03g39360.1
Glyma01g27260.1Glyma07g37460.1Glyma17g03170.1Glyma19g41970.1Glyma10g29160.1
Glyma20g38160.3Glyma20g38160.2Glyma09g04730.1Glyma09g04720.1Glyma17g04960.1
Glyma13g17550.1Glyma10g27700.1Glyma03g38230.2Glyma02g01130.1Glyma10g27710.1
Glyma19g40840.1Glyma15g16141.1
Gossypium raimondiiGorai.009G039000.1Gorai.007G340800.1Gorai.007G302000.1Gorai.006G260800.1Gorai.006G260900.1
Gorai.006G260700.1Gorai.004G238800.1Gorai.008G137200.1Gorai.004G146900.1Gorai.013G218500.1
Gorai.007G098400.1Gorai.005G257300.1
Linum usitatissimumLus10006940Lus10015211Lus10031469Lus10018335Lus10037489
Lus10039927Lus10020909Lus10027656Lus10033466Lus10023775
Lus10003968Lus10002976
Malus domesticaMDP0000545023.286.580MDP0000545023.286.580MDP0000267129MDP0000823143MDP0000785852
MDP0000193371MDP0000136674MDP0000200340MDP0000686191MDP0000389664
MDP0000850802MDP0000304455.261.433MDP0000304455.261.433
Manihot esculentacassava4.1_025863mcassava4.1_030825mcassava4.1_027130mcassava4.1_027642mcassava4.1_033112m
cassava4.1_024664mcassava4.1_029816mcassava4.1_029447mcassava4.1_030418mcassava4.1_032868m
Medicago truncatulaMedtr7g112590.1Medtr1g083510.1Medtr1g083500.1Medtr1g083470.1Medtr1g083490.1
Medtr4g005170.1Medtr4g005180.1Medtr1g086190.1Medtr1g086210.1Medtr4g124550.1
Medtr2g044650.1Medtr7g110440.1Medtr7g110510.1Medtr7g110490.1Medtr7g110560.1
Medtr7g110420.1Medtr8g088610.1Medtr5g083620.1Medtr5g083590.1
Mimulus guttatusmgv1a003232mmgv1a003546mmgv1a000814mmgv1a002232mmgv1a003747m
mgv1a003776mmgv1a004121mmgv1a003434mmgv1a003444mmgv1a003726m
mgv1a003697mmgv1a012115mmgv1a027033m
Oryza sativaLOC_Os04g38560.1LOC_Os09g26360.1LOC_Os04g54850.1LOC_Os03g18860.1LOC_Os08g34910.1
LOC_Os03g28090.1LOC_Os07g49100.1
Panicum virgatumPavirv00011682mPavirv00013701mPavirv00057767mPavirv00019846mPavirv00022990m
Pavirv00056855mPavirv00035617mPavirv00014003mPavirv00066510mPavirv00001150m
Phaseolus vulgarisPhvul.007G210400.1Phvul.003G107300.1Phvul.005G015000.1Phvul.005G104100.1Phvul.006G088200.1
Phvul.009G250600.1Phvul.009G222600.1Phvul.007G198100.1Phvul.003G126700.1Phvul.007G198100.2
Phvul.001G217400.1Phvul.001G217300.1Phvul.007G210300.1Phvul.007G210200.1
Populus trichocarpaPotri.018G051200.1Potri.006G134700.1Potri.T030500.1Potri.005G022900.1Potri.013G013400.1
Potri.001G209000.1Potri.003G021600.1Potri.003G021300.1Potri.001G209200.1
Prunus persicappa023802mppa003528mppa026560mppa025631mppa024011m
ppa003441mppa023319mppa003569mppa020185mppa003369m
Ricinus communis29739.m00367629726.m00408330128.m00885829889.m00339630116.m000390
30116.m000389
Setaria italicaSi009724mSi009788mSi015620mSi032329mSi032614m
Si040154m
Sorghum bicolorSb06g018850.1Sb06g030310.1Sb01g037900.1Sb07g022100.1Sb02g025460.1
Sb01g033140.1Sb02g043780.1
Thellungiella halophilaThhalv10003734mThhalv10020314mThhalv10003919mThhalv10020401mThhalv10024582m
Thhalv10024699mThhalv10001934mThhalv10001369mThhalv10005855m
Vitis viniferaGSVIVT01035108001GSVIVT01031165001GSVIVT01017687001GSVIVT01028264001GSVIVT01028265001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)