y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.006G265600.1
FamilyGT8
Protein PropertiesLength: 333 Molecular Weight: 38112.5 Isoelectric Point: 4.6089
ChromosomeChromosome/Scaffold: 06 Start: 50440902 End: 50443313
Descriptiongalactinol synthase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT8142600
  RAYVTFLAGNGDYVKGVVGLAKGLRKAKSLYPLVVAVLPDVPCDHREILRSQGCIVREIESVYPPENQTQFAMAYYVINYSKLRIWEFVEYEKMIYLDGD
  IQVMDNIDHLFELEDGYFYAVMDCFCEKTWSNSPQYKIGYCQQCPEKTKWPVGMGSAPPRYFNAGMFVYQPCLFTYCRLLETLKVTPPTSFAEQDFLNMF
  FRDIYKPIPPTYNLVLALLWRHPENIDLDQVKVVHYCAAGSKPWRYT
Full Sequence
Protein Sequence     Length: 333     Download
MSPNVVVSGN NPNRAYVTFL AGNGDYVKGV VGLAKGLRKA KSLYPLVVAV LPDVPCDHRE    60
ILRSQGCIVR EIESVYPPEN QTQFAMAYYV INYSKLRIWE FVEYEKMIYL DGDIQVMDNI    120
DHLFELEDGY FYAVMDCFCE KTWSNSPQYK IGYCQQCPEK TKWPVGMGSA PPRYFNAGMF    180
VYQPCLFTYC RLLETLKVTP PTSFAEQDFL NMFFRDIYKP IPPTYNLVLA LLWRHPENID    240
LDQVKVVHYC AAGSKPWRYT GKEENMDRED IKLLVKKWWD IYEDESLDDK NNNLITTAAI    300
DEPEKLGSLV STTLSEDDDG VVNPQWTAPS AA*                                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00505Glyco_transf_84.0e-1517259267+
cd04194GT8_A4GalT_like8.0e-16103259174+
pfam01501Glyco_transf_84.0e-5817261264+
cd02537GT8_Glycogenin1.0e-8514285275+
PLN00176PLN00176014332319+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN74708.101333219325hypothetical protein [Vitis vinifera]
RefSeqXP_002281304.101333219325PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281369.101333219324PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002314975.1013321325predicted protein [Populus trichocarpa]
RefSeqXP_002512546.101533227338conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3u2x_B6e-18132874259A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB3u2x_A6e-18132874259A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB3u2v_B6e-18132874259A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB3u2v_A6e-18132874259A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB3u2u_B6e-18132874259A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CV198253279142920
DT564633278142910
CK278474278142900
HO795661324143330
HO777691324143330
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00432.1Aquca_025_00352.1Aquca_003_00432.2Aquca_025_00352.3Aquca_025_00352.4
Aquca_025_00352.2Aquca_022_00310.2Aquca_022_00310.1Aquca_015_00079.1Aquca_014_00269.2
Aquca_014_00269.1Aquca_054_00102.1Aquca_054_00101.1Aquca_034_00370.2Aquca_034_00370.1
Aquca_013_00723.1
Arabidopsis lyrata475283483894311978492188474819
875919862746328405476876479372
488728337776470978482539329850
Arabidopsis thalianaAT1G60470.1AT2G47180.1AT1G09350.1AT4G26250.1AT1G56600.1
AT1G60450.1AT5G23790.1AT5G30500.1AT1G77130.1AT3G18660.3
AT3G18660.2AT3G18660.1AT4G33330.2AT4G33330.1AT5G18480.1
AT1G54940.1AT1G08990.1AT2G35710.1AT4G16600.1AT2G35710.2
Brachypodium distachyonBradi1g17200.1Bradi1g64120.1Bradi2g56810.1Bradi2g24737.1Bradi5g27680.1
Bradi3g45800.1Bradi1g72350.1Bradi5g17880.1Bradi5g15780.1Bradi3g49197.1
Bradi3g33080.1
Brassica rapaBra021388Bra027156Bra004474Bra031663Bra027922
Bra027157Bra007842Bra010438Bra032505Bra031509
Bra017919Bra016419Bra023678Bra037570Bra027954
Bra006462Bra040140Bra030750Bra022342Bra011433
Bra034558Bra008292Bra031653Bra005312Bra017301
Bra038490
Carica papayaevm.model.supercontig_145.23evm.model.supercontig_48.195evm.model.supercontig_69.62evm.model.supercontig_146.68evm.model.supercontig_42.120
evm.model.supercontig_49.61evm.model.supercontig_49.12evm.model.supercontig_51.6evm.model.supercontig_48.45evm.model.supercontig_29.157
Capsella rubellaCarubv10020626mCarubv10025703mCarubv10009676mCarubv10020539mCarubv10022341m
Carubv10006472mCarubv10006670mCarubv10019986mCarubv10013152mCarubv10004410m
Carubv10013391mCarubv10000689mCarubv10011725mCarubv10021810mCarubv10022998m
Carubv10007263m
Chlamydomonas reinhardtiiCre10.g422450.t1.2
Citrus clementinaCiclev10032043mCiclev10021027mCiclev10001308mCiclev10006683mCiclev10005406m
Ciclev10025272mCiclev10003328mCiclev10000658mCiclev10031795mCiclev10031149m
Ciclev10000664mCiclev10004021mCiclev10019980m
Citrus sinensisorange1.1g019647morange1.1g037698morange1.1g024367morange1.1g020230morange1.1g025063m
orange1.1g006648morange1.1g043696morange1.1g007705morange1.1g016559morange1.1g008931m
orange1.1g037463morange1.1g011823m
Cucumis sativusCucsa.192640.1Cucsa.135140.1Cucsa.286110.1Cucsa.180650.1Cucsa.101040.1
Cucsa.077060.1Cucsa.232920.1Cucsa.091510.1Cucsa.178260.1
Eucalyptus grandisEucgr.B01793.1Eucgr.L00245.1Eucgr.L00234.1Eucgr.B01791.1Eucgr.L00248.1
Eucgr.H02584.1Eucgr.H00906.1Eucgr.L00243.1Eucgr.K03563.1Eucgr.L00240.1
Eucgr.L00250.1Eucgr.L03185.1Eucgr.L00241.1Eucgr.L00249.1Eucgr.L00251.1
Eucgr.L00235.1Eucgr.B03987.1Eucgr.K03563.2Eucgr.L01804.1Eucgr.H03312.1
Eucgr.H02584.2Eucgr.H00902.1Eucgr.H02584.4Eucgr.H02584.3Eucgr.L03244.1
Eucgr.F04263.1Eucgr.H04942.2Eucgr.H04942.1Eucgr.F02737.2Eucgr.F02737.1
Eucgr.F00232.4Eucgr.F00232.3Eucgr.F00232.2Eucgr.F00232.1Eucgr.L01540.1
Eucgr.H04216.1Eucgr.D02078.1
Fragaria vescamrna24544.1-v1.0-hybridmrna00243.1-v1.0-hybridmrna05015.1-v1.0-hybridmrna00244.1-v1.0-hybridmrna10568.1-v1.0-hybrid
mrna22553.1-v1.0-hybridmrna17874.1-v1.0-hybridmrna09093.1-v1.0-hybridmrna32694.1-v1.0-hybridmrna16694.1-v1.0-hybrid
mrna08940.1-v1.0-hybrid
Glycine maxGlyma19g40680.1Glyma03g38080.1Glyma10g28610.1Glyma20g22700.1Glyma19g41550.1
Glyma03g38910.1Glyma10g28610.3Glyma10g28610.4Glyma19g41550.2Glyma14g28370.1
Glyma0214s00200.2Glyma02g40480.1Glyma04g04080.1Glyma06g15690.2Glyma04g39240.3
Glyma04g39240.2Glyma05g32370.1Glyma19g43630.2Glyma19g43630.1Glyma03g40980.2
Glyma19g42380.1Glyma14g09070.2Glyma14g09070.1Glyma20g37000.1Glyma17g36100.2
Glyma17g36100.1Glyma17g15060.2Glyma05g04630.1Glyma10g29570.1Glyma05g04770.2
Glyma11g03550.1Glyma17g15060.1
Gossypium raimondiiGorai.007G120900.1Gorai.001G145800.1Gorai.013G130900.1Gorai.013G130800.1Gorai.004G235400.1
Gorai.013G208500.1Gorai.001G145800.2Gorai.007G120900.3Gorai.007G120900.2Gorai.009G211400.1
Gorai.013G105100.2Gorai.013G105100.1Gorai.009G284700.2Gorai.009G284700.1Gorai.007G064800.1
Gorai.011G116600.2Gorai.011G116600.1Gorai.010G019500.2Gorai.010G019500.1Gorai.013G188300.2
Gorai.013G188300.1Gorai.013G123900.1Gorai.007G296600.1Gorai.008G235400.1Gorai.008G235400.2
Gorai.004G198800.1
Linum usitatissimumLus10031434Lus10010897Lus10029145Lus10013020Lus10028623
Lus10018922Lus10021731Lus10042658Lus10020890Lus10031507
Lus10029932Lus10033485Lus10027949Lus10008518Lus10000817
Lus10004717
Malus domesticaMDP0000587199MDP0000466683MDP0000446914MDP0000209143MDP0000412025
MDP0000251505MDP0000208137MDP0000231923MDP0000213439MDP0000267261
MDP0000245723MDP0000426442MDP0000277292MDP0000194880MDP0000759375
MDP0000469141MDP0000145543MDP0000122884MDP0000435532MDP0000188710
MDP0000121520MDP0000770666MDP0000169375MDP0000135261
Manihot esculentacassava4.1_011421mcassava4.1_011712mcassava4.1_011354mcassava4.1_011321mcassava4.1_011281m
cassava4.1_033855mcassava4.1_011443mcassava4.1_013310mcassava4.1_030206mcassava4.1_022630m
cassava4.1_013588mcassava4.1_034158mcassava4.1_003358mcassava4.1_004131mcassava4.1_026805m
cassava4.1_005360mcassava4.1_031907mcassava4.1_033739mcassava4.1_005861m
Medicago truncatulaMedtr1g084670.1Medtr7g109920.1Medtr1g084660.1Medtr1g019530.1Medtr3g095910.1
Medtr1g019540.2Medtr1g019540.1Medtr1g082880.1Medtr7g113610.1Medtr4g100950.1
Medtr1g080460.1Medtr5g012590.1
Mimulus guttatusmgv1a009552mmgv1a009966mmgv1a009667mmgv1a009861mmgv1a010175m
mgv1a010084mmgv1a019439mmgv1a010839mmgv1a011566mmgv1a024625m
mgv1a024099mmgv1a018384mmgv1a017852mmgv1a005329mmgv1a024363m
mgv1a004141mmgv1a003570mmgv1a006109mmgv1a005786m
Oryza sativaLOC_Os03g20120.1LOC_Os07g48830.1LOC_Os07g48830.2LOC_Os01g65780.4LOC_Os01g65780.3
LOC_Os01g65780.2LOC_Os01g65780.1LOC_Os03g08600.2LOC_Os03g08600.1LOC_Os04g46750.1
LOC_Os02g35020.1LOC_Os02g41520.1LOC_Os04g43700.1LOC_Os10g40640.1LOC_Os04g46750.2
Panicum virgatumPavirv00036507mPavirv00001567mPavirv00005442mPavirv00048235mPavirv00008366m
Pavirv00008365mPavirv00030002mPavirv00065220mPavirv00043231mPavirv00008772m
Pavirv00011825mPavirv00011585mPavirv00055476mPavirv00025866mPavirv00027578m
Pavirv00033942mPavirv00015870mPavirv00044458mPavirv00051192m
Physcomitrella patensPp1s21_381V6.1Pp1s223_30V6.1Pp1s351_36V6.1Pp1s426_22V6.1Pp1s38_384V6.1
Pp1s29_109V6.1Pp1s315_54V6.1Pp1s217_73V6.1Pp1s5_163V6.3
Phaseolus vulgarisPhvul.001G215300.1Phvul.007G203400.1Phvul.001G223700.1Phvul.001G073100.1Phvul.009G148800.1
Phvul.006G104100.1Phvul.009G064700.1Phvul.001G021800.1Phvul.006G092200.1Phvul.007G116100.1
Phvul.002G063000.1Phvul.003G220400.1
Picea abiesMA_67331g0010MA_7766880g0010MA_3384g0010MA_10433268g0010MA_10382669g0010
MA_10312128g0010MA_99835g0010MA_10431455g0010MA_6110g0010MA_29551g0010
MA_69375g0010MA_42938g0010MA_4176905g0010MA_35705g0010MA_84103g0010
MA_529833g0010MA_10434131g0010MA_13386g0010MA_10437270g0020MA_10149957g0010
MA_103998g0010
Populus trichocarpaPotri.002G191600.1Potri.014G116800.1Potri.013G005800.1Potri.010G150400.1Potri.013G005900.1
Potri.010G042000.1Potri.008G189400.1Potri.014G116800.2Potri.005G006800.1Potri.008G101000.1
Potri.013G005800.3Potri.013G005900.2Potri.008G189400.2Potri.013G005800.2Potri.T155800.1
Potri.014G116800.3Potri.013G005900.3Potri.008G189400.3Potri.005G006800.2Potri.008G189400.5
Potri.008G189400.4Potri.005G187900.3Potri.005G187900.2Potri.005G187900.1Potri.007G107200.2
Potri.007G107200.1Potri.005G061600.4Potri.005G061600.3Potri.005G061600.1Potri.007G107200.3
Potri.014G029900.2Potri.014G029900.1Potri.005G061600.2Potri.005G033500.1Potri.013G049100.3
Potri.013G049100.2Potri.013G049100.1Potri.013G022900.1Potri.001G158000.1Potri.003G076800.1
Potri.001G158000.2
Prunus persicappa008264mppa007982mppa008521mppa008294mppa015580m
ppa002694mppa002697mppa022628mppa003165mppa003817m
ppa005317m
Ricinus communis30076.m00460530128.m00894530128.m00894629889.m00335529631.m001017
27985.m00087030170.m01388230136.m00102629680.m00172230128.m008770
29916.m000523
Setaria italicaSi036484mSi030450mSi000669mSi021461mSi034817m
Si010011mSi009589mSi004468mSi035436mSi010456m
Selaginella moellendorffii11208483323131094738561168
16367962883
Sorghum bicolorSb01g037090.1Sb02g043450.1Sb03g041660.1Sb09g020930.1Sb03g040240.1
Sb06g022680.1Sb01g044930.1Sb04g022700.1Sb06g024740.1Sb01g029400.1
Thellungiella halophilaThhalv10023585mThhalv10001530mThhalv10008154mThhalv10023858mThhalv10009767m
Thhalv10004562mThhalv10024122mThhalv10027432mThhalv10007050mThhalv10020243m
Thhalv10013196mThhalv10024070mThhalv10020458mThhalv10024741mThhalv10007230m
Thhalv10016563mThhalv10027002m
Vitis viniferaGSVIVT01031274001GSVIVT01028174001GSVIVT01034938001GSVIVT01013763001GSVIVT01017634001
GSVIVT01028176001GSVIVT01031278001GSVIVT01031282001GSVIVT01031280001GSVIVT01031276001
GSVIVT01031284001GSVIVT01026525001GSVIVT01009501001GSVIVT01000046001GSVIVT01023535001
GSVIVT01006161001
Volvox carteriVocar20004836m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)