y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G020500.2
FamilyGH37
Protein PropertiesLength: 573 Molecular Weight: 65364.8 Isoelectric Point: 5.7783
ChromosomeChromosome/Scaffold: 07 Start: 1510418 End: 1515148
Descriptiontrehalase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH37485600
  DHKDFIDLSLKFDLSTTVKSFDEISKTENGSVSTKDFEEFIGKWFKGAGEDLVYVEPMDFETEPYGFLPKVENPEVRAWALEVHGLWKKLSREVSSSVHD
  HPELHTLLPLPVPGMIPGSRFREVYYWDSYWVIRGLLASKMHETAKAIVTNLISLLDTYGYVLNGARAYYTNRSQPPLLSAMVYEIYNRTGDVDLAKKAL
  PALLKEYQFWNSEIHTMIIHDAENCNHSLNRYYAMWNKPRPEASAIDKRFASKFLNVNEKQKFYRELASTAESGWDFSTRWMRNPSEFTSLSTTTILPVD
  LNAFMLRMELDIAFFAKIVGDDAIAEDFLTASHTRKKAFNCVFWNENMGQWVDYWLNYGAEPKEPQTWEAQNQNQNVFASNFVPLWIDLFNSDTPLVEKV
  TRSLQSSGLLCAAGIATSLTNSGHQWDFPNGWAPIQHMIVEGLWRSASTEARKVARDIAERWIRANYVAYKKTGTMHEKYNVEKCGEYGAGGIYRPQTGF
  GWSNGVVLAFLEE
Full Sequence
Protein Sequence     Length: 573     Download
MAAANHSPSS PYSCAKDSGP VIPTTSLVTF LERVQETAFQ TYERSKFDHK DFIDLSLKFD    60
LSTTVKSFDE ISKTENGSVS TKDFEEFIGK WFKGAGEDLV YVEPMDFETE PYGFLPKVEN    120
PEVRAWALEV HGLWKKLSRE VSSSVHDHPE LHTLLPLPVP GMIPGSRFRE VYYWDSYWVI    180
RGLLASKMHE TAKAIVTNLI SLLDTYGYVL NGARAYYTNR SQPPLLSAMV YEIYNRTGDV    240
DLAKKALPAL LKEYQFWNSE IHTMIIHDAE NCNHSLNRYY AMWNKPRPEA SAIDKRFASK    300
FLNVNEKQKF YRELASTAES GWDFSTRWMR NPSEFTSLST TTILPVDLNA FMLRMELDIA    360
FFAKIVGDDA IAEDFLTASH TRKKAFNCVF WNENMGQWVD YWLNYGAEPK EPQTWEAQNQ    420
NQNVFASNFV PLWIDLFNSD TPLVEKVTRS LQSSGLLCAA GIATSLTNSG HQWDFPNGWA    480
PIQHMIVEGL WRSASTEARK VARDIAERWI RANYVAYKKT GTMHEKYNVE KCGEYGAGGI    540
YRPQTGFGWS NGVVLAFLEE FGWPKDQNID CN*                                 600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13272treA4.0e-78133562440+
PRK13271treA6.0e-81130559436+
COG1626TreA5.0e-90108562474+
PLN02567PLN02567021571554+
pfam01204Trehalase047562523+
Gene Ontology
GO TermDescription
GO:0004555alpha,alpha-trehalase activity
GO:0005991trehalose metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002263698.102057212565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303674.10105718568predicted protein [Populus trichocarpa]
RefSeqXP_002303675.101957115568predicted protein [Populus trichocarpa]
RefSeqXP_002518875.1095714567alpha,alpha-trehalase, putative [Ricinus communis]
RefSeqXP_002523413.102157116566alpha,alpha-trehalase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wyn_D012157080510A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB2wyn_C012157080510A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB2wyn_B012157080510A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB2wyn_A012157080510A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB2jjb_D012157080510A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW2310382293455730
DT4646192612985580
DT57128229393010
FQ4803532872725570
FQ4526012892705570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00232.1Aquca_037_00231.2Aquca_037_00231.1
Arabidopsis lyrata914188
Arabidopsis thalianaAT4G24040.1
Brachypodium distachyonBradi3g31410.3Bradi3g31410.2Bradi3g31410.1
Brassica rapaBra013756Bra019249
Carica papayaevm.model.supercontig_15.13
Capsella rubellaCarubv10006565m
Chlamydomonas reinhardtiiCre03.g195600.t1.2.34.224Cre03.g195600.t1.2.34.224Cre03.g195600.t1.2.267.650Cre03.g195600.t1.2.267.650
Citrus clementinaCiclev10023271mCiclev10033306mCiclev10001132mCiclev10001012mCiclev10001134m
Ciclev10000621mCiclev10000674m
Citrus sinensisorange1.1g041103m.84.216orange1.1g037772m.219.456orange1.1g037772m.219.456orange1.1g047407morange1.1g041103m.217.446
orange1.1g041103m.217.446orange1.1g037772m.86.219orange1.1g037772m.86.219orange1.1g041103m.84.216
Cucumis sativusCucsa.303880.1
Eucalyptus grandisEucgr.E01027.1Eucgr.E01027.2
Fragaria vescamrna25101.1-v1.0-hybrid
Glycine maxGlyma05g36580.2Glyma05g36580.1
Gossypium raimondiiGorai.003G075200.1Gorai.007G020500.1
Linum usitatissimumLus10023035Lus10032434Lus10023034Lus10032435
Malus domesticaMDP0000315187.328.541MDP0000235673.82.325MDP0000315187.82.325MDP0000315187.82.325MDP0000235673.82.325
MDP0000235673.328.541MDP0000315187.328.541MDP0000235673.328.541
Manihot esculentacassava4.1_015916mcassava4.1_004491mcassava4.1_023202m
Mimulus guttatusmgv1a003260m
Oryza sativaLOC_Os10g37660.1
Panicum virgatumPavirv00009281mPavirv00064436mPavirv00062867mPavirv00064435m
Physcomitrella patensPp1s196_77V6.1Pp1s194_104V6.3Pp1s116_30V6.1Pp1s194_104V6.2Pp1s194_104V6.1
Pp1s137_159V6.1
Phaseolus vulgarisPhvul.002G301500.2Phvul.002G301500.1
Picea abiesMA_31368g0020MA_31368g0010
Populus trichocarpaPotri.001G087100.1Potri.003G144000.1Potri.006G068300.1Potri.003G143900.1Potri.001G087100.2
Prunus persicappa003514m
Ricinus communis28842.m00094530068.m002541
Setaria italicaSi034760m
Selaginella moellendorffii90006177119156751109304
Sorghum bicolorSb01g031280.1
Thellungiella halophilaThhalv10024684m
Vitis viniferaGSVIVT01019610001
Volvox carteriVocar20003462m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny