y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G039800.4
FamilyGT75
Protein PropertiesLength: 195 Molecular Weight: 22196.4 Isoelectric Point: 5.7223
ChromosomeChromosome/Scaffold: 07 Start: 2777913 End: 2780175
Descriptionreversibly glycosylated polypeptide 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT75131940
  LKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPSKAIKVPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMISKKKYIYTIDDDCFVAK
  DPSGKDINALEQHIKNLLSPSTPFFFNTLYDPYRAGADFVRGYPFSLREGVPTAVSHGLWLNIPDYDAPTQLVKPLERNTRY
Full Sequence
Protein Sequence     Length: 195     Download
MADPATISPA TLLKDELDIV IPTIRNLDFL EMWRPFFQPY HLIIVQDGDP SKAIKVPEGF    60
DYELYNRNDI NRILGPKASC ISFKDSACRC FGYMISKKKY IYTIDDDCFV AKDPSGKDIN    120
ALEQHIKNLL SPSTPFFFNT LYDPYRAGAD FVRGYPFSLR EGVPTAVSHG LWLNIPDYDA    180
PTQLVKPLER NTRY*                                                     240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03214RGP3.0e-11310194187+
PLN03180PLN031805.0e-1495194190+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0007047: GO:0044234
GO:0008466glycogenin glucosyltransferase activity
GO:0016758transferase activity, transferring hexosyl groups
GO:0030054cell junction
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABG76000.1051942191GRP-like protein 2 [Gossypium hirsutum]
GenBankACU23018.1011941195unknown [Glycine max]
EMBLCAC83750.1051942191reversibly glycosylated polypeptide [Gossypium hirsutum]
RefSeqNP_001148994.1051944193LOC100282614 [Zea mays]
RefSeqXP_002514626.1011941194Alpha-1,4-glucan-protein synthase [UDP-forming], putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT56840919411940
DT55861419411940
DT56062219411940
DT55119519411940
DT54325219411940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00413.1Aquca_002_00849.1Aquca_011_00106.2Aquca_011_00106.1Aquca_002_00849.2
Aquca_058_00152.1Aquca_002_00849.3Aquca_002_00849.4
Arabidopsis lyrata477458488410317692918103333145
488506
Arabidopsis thalianaAT3G02230.1AT3G08900.1AT5G15650.1AT5G50750.1AT5G16510.2
AT5G16510.1
Brachypodium distachyonBradi1g21990.1Bradi1g15050.1Bradi2g50660.1Bradi5g24850.2
Brassica rapaBra001037Bra021473Bra039165Bra008683Bra001338
Bra006315Bra029728Bra000628Bra008616Bra023530.143.331
Bra023530.143.331Bra023530.18.141Bra023530.18.141Bra023571Bra006359
Carica papayaevm.model.supercontig_1095.2evm.model.supercontig_1.156evm.model.supercontig_14.210evm.model.supercontig_123.13
Capsella rubellaCarubv10014051mCarubv10015472mCarubv10001241mCarubv10027526mCarubv10002568m
Chlamydomonas reinhardtiiCre13.g565800.t1.2
Citrus clementinaCiclev10020723mCiclev10031914mCiclev10011996mCiclev10033661mCiclev10013540m
Citrus sinensisorange1.1g018080morange1.1g017862morange1.1g024882morange1.1g025304morange1.1g045145m
orange1.1g048449morange1.1g039651morange1.1g038078m
Cucumis sativusCucsa.113400.1Cucsa.327910.1Cucsa.198650.1Cucsa.174470.1Cucsa.285070.2
Cucsa.285070.1
Eucalyptus grandisEucgr.K02544.2Eucgr.K02544.1Eucgr.I02055.1Eucgr.B00630.1Eucgr.B01380.1
Fragaria vescamrna26116.1-v1.0-hybridmrna06291.1-v1.0-hybridmrna04238.1-v1.0-hybridmrna16775.1-v1.0-hybrid
Glycine maxGlyma02g13330.1Glyma01g07930.1Glyma06g22440.1Glyma13g06690.1Glyma04g32080.1
Glyma19g04240.1Glyma18g50780.1Glyma08g27590.1Glyma08g27590.2Glyma04g32080.2
Glyma18g47520.3Glyma18g47520.2Glyma09g38800.5Glyma09g38800.4
Gossypium raimondiiGorai.001G076300.1Gorai.001G196500.1Gorai.008G200200.1Gorai.007G039800.2Gorai.001G090200.1
Gorai.007G039800.1Gorai.007G176700.1Gorai.001G208000.1Gorai.013G095500.1Gorai.008G200200.2
Gorai.008G200200.3Gorai.007G039800.3Gorai.013G095500.3Gorai.001G196500.2Gorai.013G095500.2
Gorai.004G260800.1Gorai.013G180500.3Gorai.013G180500.2Gorai.013G180500.1Gorai.013G095500.4
Gorai.007G039800.5Gorai.008G200200.4
Linum usitatissimumLus10000646Lus10036970Lus10005076Lus10017868Lus10026676
Lus10004640Lus10022443Lus10034376Lus10016749Lus10034665
Lus10009555Lus10020379Lus10034664Lus10033057
Malus domesticaMDP0000232047MDP0000174584MDP0000394728MDP0000286141MDP0000291731
MDP0000778464MDP0000146639.162.400MDP0000146639.162.400MDP0000631513MDP0000265452
MDP0000156652MDP0000461829MDP0000156837MDP0000204345MDP0000236647
MDP0000844514MDP0000146639.13.109MDP0000146639.13.109MDP0000811808MDP0000595769
MDP0000532585MDP0000512932MDP0000133673
Manihot esculentacassava4.1_010056mcassava4.1_010414mcassava4.1_010408mcassava4.1_010334mcassava4.1_010183m
cassava4.1_010136mcassava4.1_026327mcassava4.1_024143mcassava4.1_010799m
Medicago truncatulaMedtr5g046030.1Medtr7g079490.2Medtr7g079490.1
Mimulus guttatusmgv1a008980mmgv1a008906mmgv1a008625mmgv1a009275mmgv1a009196m
mgv11b024632m
Oryza sativaLOC_Os03g40270.1LOC_Os07g41360.1LOC_Os04g56520.2LOC_Os04g56520.1
Panicum virgatumPavirv00056327mPavirv00011249mPavirv00032019mPavirv00056328mPavirv00013211m
Pavirv00003673mPavirv00029652mPavirv00021282m
Physcomitrella patensPp1s66_154V6.1Pp1s131_34V6.1Pp1s131_32V6.1Pp1s66_157V6.2Pp1s66_157V6.1
Pp1s66_155V6.2Pp1s66_155V6.1Pp1s131_30V6.1Pp1s180_12V6.1
Phaseolus vulgarisPhvul.003G040000.1Phvul.008G028900.1Phvul.004G041600.1Phvul.009G203300.1Phvul.008G056100.2
Phvul.008G056100.1
Picea abiesMA_162652g0010MA_6359g0010.86.328MA_6359g0010.86.328MA_514703g0010MA_148285g0010
MA_147184g0010MA_18309g0010.83.291MA_18309g0010.83.291MA_69216g0010MA_10315336g0010
MA_7564826g0010MA_467383g0010MA_10361993g0010MA_10435046g0010
Populus trichocarpaPotri.010G156700.1Potri.008G097600.1Potri.004G117800.1Potri.015G060300.1Potri.017G099100.1
Potri.012G101100.1Potri.015G099300.1Potri.019G051700.1Potri.T057400.1
Prunus persicappa007588mppa007760mppa007756mppa017775mppa007906m
ppa007905mppa022800m.145.383ppa022800m.145.383ppa022800m.145.383ppa022800m.14.111
ppa022800m.14.111ppa022800m.14.111ppa022800m.384.458ppa022800m.384.458ppa022800m.384.458
Ricinus communis30138.m00394430174.m00908530147.m01447329790.m00080730128.m009012
Setaria italicaSi036300mSi030277mSi037048mSi024494m
Selaginella moellendorffii1400717644696340437552
Sorghum bicolorSb02g038770.1Sb01g015090.1Sb03g035320.1Sb06g031590.1
Thellungiella halophilaThhalv10021014mThhalv10013907mThhalv10022220mThhalv10013945mThhalv10019616m
Thhalv10013999m
Vitis viniferaGSVIVT01008552001GSVIVT01008133001GSVIVT01012244001GSVIVT01036557001GSVIVT01019151001
Volvox carteriVocar20009212mVocar20013853mVocar20014914m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)