y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G064900.1
FamilyCE8
Protein PropertiesLength: 578 Molecular Weight: 63339.6 Isoelectric Point: 8.5114
ChromosomeChromosome/Scaffold: 07 Start: 4562035 End: 4564923
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82625690
  DVTVCKDGRGGCYKTVQEAVNAAPAPANAESTRRFVIYIKEGVYEETVRVPLEKKNVVFLGDGMGKTIIAGALNAGMPGLTTYETATVGVLGDGFMASGL
  TIRNTAGPDAHQAVAFRSDSDLSVIENCEFLGNQDTLYAHSLRQFYRKCRIQGNVDFIFGNSASVFQDCEILVAPRQVKPEKGENNAVTAHGRTDPAQST
  GLVFQNCLINGTDEYMRYYYSKPKVHKNFLGRPWKEYSRTVFINCVMEALINPNGWMPWKGDFALKTLFYGEFGNSGLGSIPLNRVPWSTQIPPQHVHTF
  SVQNFIQG
Full Sequence
Protein Sequence     Length: 578     Download
MHSSSPPPSH QSHKKHPRRN PWNSTSLLVS LSMSAFLLLS LLSLSHFFIF SSSSHHPPHN    60
SPVYASDSSR IRLACKSTRF PQPCESSLSR SSLLPPNPTS LQFIQSAISV SSDNLKTGQS    120
MVKSILDSSK GNLNRSNAAA ICLNILSNSD YRIRSTNAAL ARGKIKDARA WMSAALCYQY    180
DCWSALKYVN DTKLVGETMA FLDSLTQHSS NALSMMVAYD NIGEDIAAWV PPKTERDGFY    240
ENGSGGTELG FNGGLPSNLK TDVTVCKDGR GGCYKTVQEA VNAAPAPANA ESTRRFVIYI    300
KEGVYEETVR VPLEKKNVVF LGDGMGKTII AGALNAGMPG LTTYETATVG VLGDGFMASG    360
LTIRNTAGPD AHQAVAFRSD SDLSVIENCE FLGNQDTLYA HSLRQFYRKC RIQGNVDFIF    420
GNSASVFQDC EILVAPRQVK PEKGENNAVT AHGRTDPAQS TGLVFQNCLI NGTDEYMRYY    480
YSKPKVHKNF LGRPWKEYSR TVFINCVMEA LINPNGWMPW KGDFALKTLF YGEFGNSGLG    540
SIPLNRVPWS TQIPPQHVHT FSVQNFIQGD QWIPTSS*                            600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02713PLN027133.0e-107143576471+
PLN02468PLN024687.0e-109125576460+
PLN02301PLN023018.0e-110132573462+
pfam01095Pectinesterase9.0e-154262570312+
PLN02708PLN02708055577533+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196538.106157733551pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002281640.10345773555PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306241.105457727558predicted protein [Populus trichocarpa]
RefSeqXP_002309906.105057726564predicted protein [Populus trichocarpa]
RefSeqXP_002517239.105257722552Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02575773312A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02625764307B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B2e-1927152215284B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A2e-1927152215284B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B2e-1927152215284B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Transmembrane Domains
StartEnd
2749
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8229563811465140
ES7918892653145780
DT5713562712655350
CO1024342611434030
DT571356275285540.003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)