y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G074300.1
FamilyCE10
Protein PropertiesLength: 444 Molecular Weight: 49218.2 Isoelectric Point: 7.7912
ChromosomeChromosome/Scaffold: 07 Start: 5265220 End: 5267956
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101104330
  NIGARTNDSRRSSLEGSKLRSDNNVYRGYSPLPQNCRRLPIMLQFHGGGWVSGSNDSVANDIFCRRIAKLCDVIIVAVGYRLAPENKYPAAFEDGLKVLY
  WLAKQANLAECSKSMGSGALGVGAEFTKTQVQRHLVDAFGASMVEPWLAAHGDPSRCVLLGVSCGANIADYVARKAVEAGRLLDPVKVVAQVLMYPFFIG
  NVPTRSEINLANSYFYDKPMCLLAWKLFLPEEEFRLDHPAANPLVPDRGPPLKFMPPTLTVVAEHDWMRDRAIAYSEALRKVNVDAPVLEYKDAVHEFAT
  LDMLLNTPQAQACAEDIAIWVKKY
Full Sequence
Protein Sequence     Length: 444     Download
MPSIAVKLYS VFFKFLLKHR LQNRIQTHVD ESSNQYGVTT RPEESVSAAN PSFTDGIATK    60
DIHIDPSTAL SVRIFLPESS LSPPEPKSKP GSSQQDESDS LNHRRNSYPN IGARTNDSRR    120
SSLEGSKLRS DNNVYRGYSP LPQNCRRLPI MLQFHGGGWV SGSNDSVAND IFCRRIAKLC    180
DVIIVAVGYR LAPENKYPAA FEDGLKVLYW LAKQANLAEC SKSMGSGALG VGAEFTKTQV    240
QRHLVDAFGA SMVEPWLAAH GDPSRCVLLG VSCGANIADY VARKAVEAGR LLDPVKVVAQ    300
VLMYPFFIGN VPTRSEINLA NSYFYDKPMC LLAWKLFLPE EEFRLDHPAA NPLVPDRGPP    360
LKFMPPTLTV VAEHDWMRDR AIAYSEALRK VNVDAPVLEY KDAVHEFATL DMLLNTPQAQ    420
ACAEDIAIWV KKYISLRGHE FSY*                                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00312Esterase_lipase0.0001133275152+
PRK10162PRK101621.0e-515521662+
pfam00135COesterase7.0e-613319367+
COG0657Aes3.0e-37130427299+
pfam07859Abhydrolase_34.0e-61151408258+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAS99713.1014431428At3g27320 [Arabidopsis thaliana]
RefSeqNP_001030781.1014431428hydrolase [Arabidopsis thaliana]
RefSeqXP_002267088.1014431464PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002267130.1014431425PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002526925.1014431472conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A1e-32142410107331B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2zsh_A1e-32142410107331B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F3e-30148427112344B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E3e-30148427112344B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D3e-30148427112344B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7899763561044440
DT54625428672920
JK5155042681774440
EB4388452791664440
GO3625233041364340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1Bradi4g39410.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Fragaria vescamrna28030.1-v1.0-hybrid
Glycine maxGlyma19g24390.1Glyma16g06780.1Glyma05g06430.1Glyma19g22760.1
Gossypium raimondiiGorai.006G038400.1Gorai.007G074300.2Gorai.012G091000.1Gorai.002G190500.1Gorai.001G268100.1
Gorai.011G093200.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1Phvul.008G149400.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny