y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G095000.1
FamilyGH16
Protein PropertiesLength: 214 Molecular Weight: 24007.8 Isoelectric Point: 4.6035
ChromosomeChromosome/Scaffold: 07 Start: 6973167 End: 6974393
Descriptionxyloglucan endotransglucosylase/hydrolase 21
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16421801e-26
  GGARWRSTTRFLYGTFTSLIQCPKGNTSGLNFNIYLSSLEGDKSQDEIDFEFLGKDKTIVQTNYYTTGTGNREQIHDLGFDCSDGFHEYTIKWNPDSIEW
  VIDGKVVRKAEKKEGEAFPEKPMFLYASVWDASYIAEGQ
Full Sequence
Protein Sequence     Length: 214     Download
MADPALHHQI QPIKEIAIDY TPEACTHCPV SNSITLTFDH RGGARWRSTT RFLYGTFTSL    60
IQCPKGNTSG LNFNIYLSSL EGDKSQDEID FEFLGKDKTI VQTNYYTTGT GNREQIHDLG    120
FDCSDGFHEY TIKWNPDSIE WVIDGKVVRK AEKKEGEAFP EKPMFLYASV WDASYIAEGQ    180
WTGPYIGCDV PYVCLYKDIQ VPVSTAVECS CDS*                                240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase6.0e-2986201128+
PLN03161PLN031613.0e-2932173149+
cd02175GH16_lichenase9.0e-3643185145+
cd02176GH16_XET1.0e-4232177152+
pfam00722Glyco_hydro_167.0e-4931185156+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY88289.101121126234hypothetical protein OsI_09745 [Oryza sativa Indica Group]
RefSeqNP_001048767.101121126234Os03g0117300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150346.10320411215xyloglucan endotransglucosylase/hydrolase protein 5 [Zea mays]
RefSeqXP_002273975.1012081208PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301319.1012131213predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3o5s_A3e-234719389228A Chain A, Crystal Structure Of The Endo-Beta-1,3-1,4 Glucanase From Bacillus Subtilis (Strain 168)
PDB3d6e_B7e-238718891186A Chain A, Crystal Structure Of The Engineered 1,3-1,4-Beta-Glucanase Protein From Bacillus Licheniformis
PDB3d6e_A7e-238718891186A Chain A, Crystal Structure Of The Engineered 1,3-1,4-Beta-Glucanase Protein From Bacillus Licheniformis
PDB2vh9_B9e-233320162234A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_A9e-233320162234A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES80947021412140
ES82369121412140
JK80169721412140
DW48729521322140
DW23722921142140
Orthologous Group
SpeciesID
Citrus clementinaCiclev10022200m
Citrus sinensisorange1.1g028023m
Eucalyptus grandisEucgr.D02237.1
Fragaria vescamrna18893.1-v1.0-hybrid
Glycine maxGlyma07g08550.2
Gossypium raimondiiGorai.007G095000.2
Manihot esculentacassava4.1_016069m
Physcomitrella patensPp1s24_272V6.1Pp1s353_23V6.6Pp1s353_23V6.1Pp1s353_23V6.2Pp1s353_23V6.3
Pp1s353_23V6.4Pp1s353_23V6.5
Phaseolus vulgarisPhvul.010G092400.1
Picea abiesMA_52109g0010
Populus trichocarpaPotri.002G153200.1
Prunus persicappa027011m
Setaria italicaSi039715m
Selaginella moellendorffii75086
Sorghum bicolorSb01g049420.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny