y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G095000.2
FamilyGH16
Protein PropertiesLength: 170 Molecular Weight: 19135.4 Isoelectric Point: 6.1399
ChromosomeChromosome/Scaffold: 07 Start: 6973211 End: 6974329
Descriptionxyloglucan endotransglucosylase/hydrolase 21
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16421516.9e-24
  GGARWRSTTRFLYGTFTSLIQCPKGNTSGLNFNIYLSSLEGDKSQDEIDFEFLGKDKTIVQTNYYTTGTGNREQIHDLGFDCSDGFHEYTIKWNPDSIEW
  VIDGKVVRKA
Full Sequence
Protein Sequence     Length: 170     Download
MADPALHHQI QPIKEIAIDY TPEACTHCPV SNSITLTFDH RGGARWRSTT RFLYGTFTSL    60
IQCPKGNTSG LNFNIYLSSL EGDKSQDEID FEFLGKDKTI VQTNYYTTGT GNREQIHDLG    120
FDCSDGFHEY TIKWNPDSIE WVIDGKVVRK AEKKEGYSGA CLHCCRVFL*               180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase4.0e-2331157137+
PLN03161PLN031611.0e-2432154129+
cd02175GH16_lichenase2.0e-3243156116+
cd02176GH16_XET2.0e-3432149121+
pfam00722Glyco_hydro_162.0e-3931156127+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY88289.101115626172hypothetical protein OsI_09745 [Oryza sativa Indica Group]
RefSeqNP_001048767.101115626172Os03g0117300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150346.10315611167xyloglucan endotransglucosylase/hydrolase protein 5 [Zea mays]
RefSeqXP_002273975.1011561156PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301319.1011561156predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3i4i_B1e-214316981201A Chain A, Crystal Structure Of A Prokaryotic Beta-1,3-1,4-Glucanase (Lichenase) Derived From A Mouse Hindgut Metagenome
PDB3i4i_A1e-214316981201A Chain A, Crystal Structure Of A Prokaryotic Beta-1,3-1,4-Glucanase (Lichenase) Derived From A Mouse Hindgut Metagenome
PDB3o5s_A9e-214715489195A Chain A, Crystal Structure Of The Endo-Beta-1,3-1,4 Glucanase From Bacillus Subtilis (Strain 168)
PDB1mac_B1e-194415160166A Chain A, Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase
PDB1mac_A1e-194415160166A Chain A, Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG83744515611560
DW48729415611560
JK80169715611560
ES80947015611560
JK801697331381704.9
Orthologous Group
SpeciesID
Citrus clementinaCiclev10022200m
Citrus sinensisorange1.1g028023m
Eucalyptus grandisEucgr.D02237.1
Fragaria vescamrna18893.1-v1.0-hybrid
Glycine maxGlyma07g08550.2
Gossypium raimondiiGorai.007G095000.1
Manihot esculentacassava4.1_016069m
Physcomitrella patensPp1s24_272V6.1Pp1s353_23V6.6Pp1s353_23V6.1Pp1s353_23V6.2Pp1s353_23V6.3
Pp1s353_23V6.4Pp1s353_23V6.5
Phaseolus vulgarisPhvul.010G092400.1
Picea abiesMA_52109g0010
Populus trichocarpaPotri.002G153200.1
Prunus persicappa027011m
Setaria italicaSi039715m
Selaginella moellendorffii75086
Sorghum bicolorSb01g049420.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny