y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G104400.1
FamilyGT77
Protein PropertiesLength: 292 Molecular Weight: 33039 Isoelectric Point: 8.4571
ChromosomeChromosome/Scaffold: 07 Start: 7822347 End: 7824508
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771142794.1e-34
  QKHQEMVLGFFNFTSRRPRHLLQILELGYSVMYNDVDMVWFGDPFCYLEGNHDVYFSDDMAATLGYCKMDILCCLAAFIIYFFHASSLWLISCVIFLRPT
  DGAKLVMKKWTEELQAQPWSKAKKANDQPAFNWALNKTAGLVDLYLLPQTEFPTGGLYFKNQTWVQ
Full Sequence
Protein Sequence     Length: 292     Download
HSCVNDPSSD PFSNASPISP PSSNSQRSIS VFSRTGIIVL LSLMVILGVF TPWSGMSQSM    60
FSNSRKVSSL SKWRDYSMAE AASFVTKNGT IIVCAVSQPY LPFLNNWLIS ITRQKHQEMV    120
LGFFNFTSRR PRHLLQILEL GYSVMYNDVD MVWFGDPFCY LEGNHDVYFS DDMAATLGYC    180
KMDILCCLAA FIIYFFHASS LWLISCVIFL RPTDGAKLVM KKWTEELQAQ PWSKAKKAND    240
QPAFNWALNK TAGLVDLYLL PQTEFPTGGL YFKNQTWVQQ RANQGKERYN S*            300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans9.0e-22122265148+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ94713.106628769319putative alpha 1,3-xylosyltransferase [Linum usitatissimum]
EMBLCAN69309.10442801266hypothetical protein [Vitis vinifera]
RefSeqXP_002273155.101328020317PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279469.101228020318PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511939.1072809313conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
3557
188210
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC914138288312800
DY294483288312800
DY264723288312800
DY268036284312760
DV144009260402610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brachypodium distachyonBradi2g26850.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g027009morange1.1g021054m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Fragaria vescamrna09360.1-v1.0-hybrid
Glycine maxGlyma08g09360.1
Gossypium raimondiiGorai.004G154200.4Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.3Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010616mcassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Phaseolus vulgarisPhvul.002G188500.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny