y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G157200.1
FamilyGT1
Protein PropertiesLength: 467 Molecular Weight: 51609.7 Isoelectric Point: 6.2748
ChromosomeChromosome/Scaffold: 07 Start: 13643445 End: 13645133
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12364363.2e-26
  TQYQKPVLLTGPLTPDPPSGVLDEKWATWLAQHPPESVIFCSFGSETFLKDDQLKELATGLELTGLPFILVVNFPGGVEARAELDRVLPKGFMEAIKGRG
  VVHSGWVQQQLILAHESVGCCICHSGFSSIMEALMNDCQLVLLPLKGDQFLNAKLVAGDMKAGVEVSRREEDGYFSKENIKEAVETVMVDVDKEAGVSIR
  Q
Full Sequence
Protein Sequence     Length: 467     Download
MAGGEAKEIH AVMFPYFAFG HISPFIQLSN KLSLHGFRIS FLTPPGNVSR IKSSFLVTST    60
IQIIPIQIPK VQGLPTHLHN TSEMTPAMHE LLKEAVDLMQ PQIKTLLSEL RPQFVFFDFA    120
HHWVPKLCSQ LGIKTLSFSV FSAISGAYVT VPARFIGVET EEPTVDDLKK PPCGYPQTSF    180
TSLKAFQAQD LSYVYKSFNG RPAVYHTAVD GFNSCSAIVL KSCNEMEGPY VDFIKTQYQK    240
PVLLTGPLTP DPPSGVLDEK WATWLAQHPP ESVIFCSFGS ETFLKDDQLK ELATGLELTG    300
LPFILVVNFP GGVEARAELD RVLPKGFMEA IKGRGVVHSG WVQQQLILAH ESVGCCICHS    360
GFSSIMEALM NDCQLVLLPL KGDQFLNAKL VAGDMKAGVE VSRREEDGYF SKENIKEAVE    420
TVMVDVDKEA GVSIRQNHMK WKDFLLNAEI QDKLISNLVE QLKAMA*                  480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028634.0e-428426442+
PLN02670PLN026702.0e-819463467+
PLN00414PLN004144.0e-1028463459+
PLN02764PLN027649.0e-1078465461+
PLN02208PLN022082.0e-1177463460+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA18631.104466164751,6-rhamnosyltransferase [Citrus sinensis]
GenBankABO21810.1094664460UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia axillaris]
GenBankABO21820.1094664460UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia axillaris]
RefSeqXP_002309370.1014661465predicted protein [Populus trichocarpa]
RefSeqXP_002509496.10846610463UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A3e-22264440261440A Chain A, Histidinol-Phosphate Aminotransferase From Corynebacterium Glutamicum Holo-Form (Plp Covalently Bound )
PDB2vch_A3e-22264440261440A Chain A, Histidinol-Phosphate Aminotransferase From Corynebacterium Glutamicum Holo-Form (Plp Covalently Bound )
PDB2vce_A3e-22264440261440A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO08140627312730
DY2816893321284580
DY267300365714310
FC9081273091514580
FC915418313713810
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Glyma13g32770.1
Gossypium raimondiiGorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1Gorai.010G242800.1
Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)