y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G166200.1
FamilyGT16
Protein PropertiesLength: 440 Molecular Weight: 50003.3 Isoelectric Point: 8.1298
ChromosomeChromosome/Scaffold: 07 Start: 14683101 End: 14685425
Descriptionbeta-1,2-N-acetylglucosaminyltransferase II
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT16844190
  KINQMPPRNRDLYPKLAKDHITIVLYVHNRPQYLQVVVKSLSKVVGISETLLIVSHDGYFEDMNKIVEGIKFCQVKQIFAPFSPHVFPDSFPGVSSNDCK
  EKDDAGKKHCVGSPDQYGNHRSPRIVSLKHHWWWMMNTVWDGLKETRGHNGHILFIEEDHFIYPNAYRNLQLLVSLKPIKCPDCYAANLAPCDVNLRGEG
  WDSLIAERMGNVGYAFNWTVWRKIHRKAKEFCFFDDYNWDITMWATVYPSFGSPVYTLRGPRTSAVHFGKCGLHQGQGQTNACIDNGSVNMQVDDIDRVA
  NIRSEWGVHVYDNQPGYKAGFKGWGGWGDDRDRQLC
Full Sequence
Protein Sequence     Length: 440     Download
MLCIVCSMAN CKKLRLKDAA LKRLLSVVVV TLLGVLLLIV SLRTNTTPGL SELDEDLSEF    60
TDIQSFSEKL NLPKQNEFSI RLAKINQMPP RNRDLYPKLA KDHITIVLYV HNRPQYLQVV    120
VKSLSKVVGI SETLLIVSHD GYFEDMNKIV EGIKFCQVKQ IFAPFSPHVF PDSFPGVSSN    180
DCKEKDDAGK KHCVGSPDQY GNHRSPRIVS LKHHWWWMMN TVWDGLKETR GHNGHILFIE    240
EDHFIYPNAY RNLQLLVSLK PIKCPDCYAA NLAPCDVNLR GEGWDSLIAE RMGNVGYAFN    300
WTVWRKIHRK AKEFCFFDDY NWDITMWATV YPSFGSPVYT LRGPRTSAVH FGKCGLHQGQ    360
GQTNACIDNG SVNMQVDDID RVANIRSEWG VHVYDNQPGY KAGFKGWGGW GDDRDRQLCL    420
NFAQMYHSYN TSLSAVTMS*                                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05060MGAT24.0e-16679419364+
Gene Ontology
GO TermDescription
GO:0005795Golgi stack
GO:0008455alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0009312oligosaccharide biosynthetic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAI72505.107143171431beta 1,2 N-acetylglucosaminyltransferase [Populus alba x Populus tremula]
EMBLCAN61074.1084271426hypothetical protein [Vitis vinifera]
RefSeqXP_002268643.1084271426PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321199.107143171431predicted protein [Populus trichocarpa]
RefSeqXP_002530215.1094393437beta-1,2-n-acetylglucosaminyltransferase II, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE703894292663570
FQ4245252661293940
FQ4294272581293860
EH752342259913490
FN7094632341293620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_110_00024.1
Arabidopsis lyrata480143
Arabidopsis thalianaAT2G05320.1
Brachypodium distachyonBradi3g54230.1
Brassica rapaBra013178
Carica papayaevm.model.supercontig_136.28
Capsella rubellaCarubv10013752m
Citrus clementinaCiclev10015287m
Citrus sinensisorange1.1g048409m
Cucumis sativusCucsa.100290.1
Eucalyptus grandisEucgr.H00879.1
Fragaria vescamrna15520.1-v1.0-hybrid
Glycine maxGlyma10g25781.1Glyma20g20280.2
Gossypium raimondiiGorai.001G221700.1
Linum usitatissimumLus10001174Lus10001748
Malus domesticaMDP0000230423.81.277MDP0000762447MDP0000230423.81.277MDP0000230423.283.396MDP0000230423.283.396
Manihot esculentacassava4.1_007960m
Mimulus guttatusmgv1a026909mmgv1a018673m
Oryza sativaLOC_Os02g55470.1
Panicum virgatumPavirv00058015mPavirv00014783m
Physcomitrella patensPp1s8_84V6.1Pp1s372_1V6.1
Phaseolus vulgarisPhvul.007G239000.1
Picea abiesMA_10427700g0020MA_10427700g0010
Populus trichocarpaPotri.014G167200.1
Prunus persicappa007646m
Ricinus communis28859.m000321
Setaria italicaSi017206m
Selaginella moellendorffii80130
Sorghum bicolorSb04g036090.1
Thellungiella halophilaThhalv10002538m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny