y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G195700.1
FamilyGH9
Protein PropertiesLength: 521 Molecular Weight: 57975.1 Isoelectric Point: 4.7623
ChromosomeChromosome/Scaffold: 07 Start: 19393585 End: 19396286
Descriptionglycosyl hydrolase 9B5
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9565120
  KYADALELALQFFDVQKSGKLVDNRIPWRGDSGLQDGSEENLDLSKGMYDAGDAIKFGFPMAFTATVLSWSILEYGDQMNAVKQLGYAYNSLRWITDYLI
  NSHPSENVLYFQVGDPGLDHKCWERPETMTERRPVTQVNTSFPGTEVVAETAAALASASLVFKENDPDYSSSLLTHARQLFTFADTYRASYSISIPQVQG
  FYNSTGYGDELLWAASWLYHATRDDSYLRYVTNGQRFANMEITTWFSWDDKLAGTQVLLSRIIFFRAKDMPTVENLDLQMYRKTAELVMCGLLPDSPTAT
  SRRTDGGLIWITEWNPLQHAVASAFLAVLYSDYMLTSQTETLYCSGNSYKPDDLRNFAISQADYVLGENPMKMSYLVGYGSRYPLYVHHRGSSIPVNADT
  SCQDGFKWLYSDDPNPNIAVGALVGGPSLNDSYSDTRDNVKQSEPSTYNSALLVGLL
Full Sequence
Protein Sequence     Length: 521     Download
MGGKQAETSN PMDRGSSIWC LLVLVIGALV VTAAALTILK YLHFSKNNEA HPINKKYADA    60
LELALQFFDV QKSGKLVDNR IPWRGDSGLQ DGSEENLDLS KGMYDAGDAI KFGFPMAFTA    120
TVLSWSILEY GDQMNAVKQL GYAYNSLRWI TDYLINSHPS ENVLYFQVGD PGLDHKCWER    180
PETMTERRPV TQVNTSFPGT EVVAETAAAL ASASLVFKEN DPDYSSSLLT HARQLFTFAD    240
TYRASYSISI PQVQGFYNST GYGDELLWAA SWLYHATRDD SYLRYVTNGQ RFANMEITTW    300
FSWDDKLAGT QVLLSRIIFF RAKDMPTVEN LDLQMYRKTA ELVMCGLLPD SPTATSRRTD    360
GGLIWITEWN PLQHAVASAF LAVLYSDYML TSQTETLYCS GNSYKPDDLR NFAISQADYV    420
LGENPMKMSY LVGYGSRYPL YVHHRGSSIP VNADTSCQDG FKWLYSDDPN PNIAVGALVG    480
GPSLNDSYSD TRDNVKQSEP STYNSALLVG LLSGLISTSS V                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN021713.0e-14857517474+
PLN00119PLN001199.0e-14953515475+
PLN02340PLN023402.0e-15149520482+
pfam00759Glyco_hydro_92.0e-16157513462+
PLN02345PLN02345060521464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF42037.105352153521cellulase2 [Pyrus communis]
EMBLCBI17386.105350651506unnamed protein product [Vitis vinifera]
RefSeqXP_002276739.105352151520PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327760.104550447508predicted protein [Populus trichocarpa]
RefSeqXP_002510516.105352151518endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0575175430A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB1ksc_A0575175430A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB1ks8_A0575175430A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0575166441A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0575166441A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
1739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR2182833331915210
GR2182823251915130
DY2895473481705130
EH1885863791435190
HO7820383082165210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00072.3Aquca_007_00072.2Aquca_007_00072.1
Arabidopsis lyrata472218895440
Arabidopsis thalianaAT1G75680.1AT1G19940.1
Brachypodium distachyonBradi4g36240.1Bradi1g35220.1
Brassica rapaBra025783Bra008214Bra015827Bra012198
Carica papayaevm.model.supercontig_26.31evm.model.supercontig_6.239
Capsella rubellaCarubv10020139mCarubv10008868m
Citrus clementinaCiclev10003402mCiclev10000849mCiclev10025306m
Citrus sinensisorange1.1g009846morange1.1g036398morange1.1g048736m
Cucumis sativusCucsa.342940.1
Eucalyptus grandisEucgr.I02356.1Eucgr.F01640.1
Fragaria vescamrna14858.1-v1.0-hybridmrna08501.1-v1.0-hybrid
Glycine maxGlyma02g05510.2Glyma02g05510.1Glyma04g02740.1Glyma06g02760.1Glyma16g23930.2
Gossypium raimondiiGorai.002G123700.1Gorai.009G195400.1Gorai.010G005200.1Gorai.009G195400.2Gorai.009G195400.3
Gorai.009G195400.4
Linum usitatissimumLus10025965Lus10033156Lus10034515Lus10014265
Malus domesticaMDP0000140066.57.384MDP0000250849MDP0000140066.57.384MDP0000147635
Manihot esculentacassava4.1_005604mcassava4.1_005517mcassava4.1_005180mcassava4.1_021748m
Medicago truncatulaMedtr8g075990.1Medtr3g113720.1
Mimulus guttatusmgv1a004472mmgv1a004578m
Oryza sativaLOC_Os09g36350.2LOC_Os06g50140.1LOC_Os09g36350.1
Panicum virgatumPavirv00061954mPavirv00002469mPavirv00006523mPavirv00002468m
Physcomitrella patensPp1s308_21V6.1Pp1s60_116V6.1
Phaseolus vulgarisPhvul.009G016100.1Phvul.003G262600.1
Picea abiesMA_132273g0020
Populus trichocarpaPotri.005G115400.1Potri.005G237700.1Potri.002G023900.1
Ricinus communis30170.m01379027471.m000417
Setaria italicaSi006241mSi029476m
Selaginella moellendorffii77612144066
Sorghum bicolorSb10g030140.1Sb02g030990.1
Thellungiella halophilaThhalv10007364mThhalv10018397m
Vitis viniferaGSVIVT01018793001GSVIVT01009881001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny