y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G201600.1
FamilyGH5
Protein PropertiesLength: 1150 Molecular Weight: 129564 Isoelectric Point: 8.7418
ChromosomeChromosome/Scaffold: 07 Start: 20517853 End: 20523140
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH5413491e-30
  NGNPYFANGFNAYWLMYVASDPSQRPKVSTAFREAAAHGLTVARTWAFSDGGYRPLQYAPGSYNEQMFKGLDFVIAEARKYRIKLILSLANNYESFGGKK
  QYVNWARSQGQYLTSDDDFFRNPVVKGYYKNHVKTVLNRYNSFTGMHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWIMEMASHVKSIDRNHLLEAGLEG
  FYGQSTPQKKRLNPSLDIGTDFIANNQIPGIDFATVHSYPDQWLSSSSEQYQLSFLNNWLDAHIRDARIILRKPILLAEFGKSWKDPGFNIYQRDQLFNI
  VYNKIYWSA
Full Sequence
Protein Sequence     Length: 1150     Download
MKLHLALGFL LAVLFNQNLL TVHVEAGDDF VRTRRVHFFL NGNPYFANGF NAYWLMYVAS    60
DPSQRPKVST AFREAAAHGL TVARTWAFSD GGYRPLQYAP GSYNEQMFKG LDFVIAEARK    120
YRIKLILSLA NNYESFGGKK QYVNWARSQG QYLTSDDDFF RNPVVKGYYK NHVKTVLNRY    180
NSFTGMHYKD DPTIMAWELM NEPRCTSDPS GRTIQAWIME MASHVKSIDR NHLLEAGLEG    240
FYGQSTPQKK RLNPSLDIGT DFIANNQIPG IDFATVHSYP DQWLSSSSEQ YQLSFLNNWL    300
DAHIRDARII LRKPILLAEF GKSWKDPGFN IYQRDQLFNI VYNKIYWSAK TGGPASGGLF    360
WQLLAGGMES FRDGYEIILS ERSSTANVIA QQSHKLDQIR KIFTRRRNVQ RWKRARAKRR    420
GGWHALLGHA CFATSSDRNM VSTIRAHNLR KLCTVPNIAF IGNKDILVSQ TTSINSFRKQ    480
HVPNAINMLE LNSLLKNLVK TGDLHEARQM FDVMPQRDEV SWTIIISGYV RAMKSSEALL    540
LFSKMWVSPG LSTDPFCLSI ALKACALEFN LNYGELLHGY LVKSGFINSV FAGSALLDMY    600
AKFGKIELGI KVFDEMPIKS VVSWTAIITG LVHGGYYKKG LVYLSEMRKS GVEYDSYTLA    660
IVLKACACLG ALNFGREIHT HTVKRGFNDT SYVANSLSTM YNKCGKLDYG LRLFDKMNTR    720
DVVSWTSIIT TYVQMREDVN AIEAFTRMQE AGVSPNEFTF AAVIASCSGL VRISWGEQLH    780
AHVLRIGLAD TLSVANSLMT MYSKCGQISS AAMVFHGMSR RDTISWSTII AVYSQGGYGE    840
EAFEHLSWMR KEGPKPTQFA FASVLSVCGN MAILEQGRQL HAHVLSIGLE QEEMIQSALV    900
NMYSKCGCIK DAEKVFNEAE NYNIVTWTAM INGYADHGYI HETINLFKML SKVGLKPDSV    960
TFIGLLTACS HAGLADLGFH YFNLMSSEYQ IRPSKEHYGC MIDLLCRAGR LTEAEEMIKS    1020
MPFHRDDVVW STLLRACRVQ GNVDCGERAA EKLLEMDPNC AGTHITLANI YSAKGKWREA    1080
ADVRKMMRTK GVMKEPGWSW IKVKDRVSAF VAGERSYPEG EEIYGMLDLL ASRVDISVQE    1140
LGSLLDLED*                                                           1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03077PLN030772.0e-407411073337+
PLN03077PLN030771.0e-52485811329+
PLN03077PLN030771.0e-72491966484+
PLN03077PLN030771.0e-795741059495+
PLN03077PLN030779.0e-1614921128640+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN70631.1044311485712hypothetical protein [Vitis vinifera]
RefSeqNP_190368.10471113216685pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
RefSeqXP_002266026.1044311485712PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310258.1048811461659predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1rh9_A0263992372A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3pzq_A1.96182e-444037322352A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3pzo_A1.96182e-444037322352A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3pzn_A1.96182e-444037322352A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3pzm_A1.96182e-444037322352A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY296355336754100
ES830972269162840
CK938256300973960
HO798074367444100
DW000538296223170
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_008_00275.1Aquca_028_00132.1Aquca_036_00154.1Aquca_027_00015.1Aquca_017_00156.1
Aquca_036_00154.2Aquca_008_00275.2Aquca_010_00537.1Aquca_023_00122.1Aquca_023_00124.1
Aquca_023_00123.1Aquca_003_00212.1Aquca_023_00122.2Aquca_010_00537.3
Arabidopsis lyrata491940480902349416872461887017
470192478424
Arabidopsis thalianaAT4G28320.1AT2G20680.1AT5G01930.1AT3G10890.1AT5G66460.1
AT1G02310.1AT3G10900.1AT3G30540.1
Brachypodium distachyonBradi2g49680.1Bradi1g42770.1Bradi4g44336.1Bradi2g45790.1Bradi3g57920.1
Bradi1g03207.1Bradi4g44336.2
Brassica rapaBra026266Bra031137Bra036493Bra005662Bra034151
Bra036494Bra033312Bra012074Bra001383
Carica papayaevm.model.supercontig_34.173evm.model.supercontig_86.73evm.model.supercontig_6.153evm.model.supercontig_57.52evm.model.supercontig_21.96
Capsella rubellaCarubv10004854mCarubv10013751mCarubv10012718mCarubv10016461mCarubv10028560m
Carubv10011405mCarubv10015594mCarubv10016343m
Chlamydomonas reinhardtiiCre01.g048350.t1.2g8002.t2g8002.t1Cre02.g098000.t1.2g12094.t1
Cre07.g337750.t1.3
Citrus clementinaCiclev10015394mCiclev10011654mCiclev10001262mCiclev10020376mCiclev10023981m
Ciclev10025631m
Citrus sinensisorange1.1g014151morange1.1g014902morange1.1g014373morange1.1g012093morange1.1g014426m
orange1.1g015179morange1.1g016140morange1.1g013811morange1.1g048104m
Cucumis sativusCucsa.119110.1Cucsa.137700.1Cucsa.342570.1Cucsa.127590.1Cucsa.237330.1
Cucsa.237320.1
Eucalyptus grandisEucgr.A01823.1Eucgr.E03950.1Eucgr.K01032.1Eucgr.A00780.1Eucgr.K00548.1
Eucgr.K00551.1Eucgr.K00550.1Eucgr.I02413.1Eucgr.F02943.1Eucgr.F01879.1
Eucgr.K00551.3Eucgr.K00551.2
Fragaria vescamrna17714.1-v1.0-hybridmrna05501.1-v1.0-hybridmrna15177.1-v1.0-hybridmrna13566.1-v1.0-hybridmrna22956.1-v1.0-hybrid
Glycine maxGlyma13g37250.1Glyma12g33200.1Glyma06g44750.1Glyma12g12770.1Glyma03g00440.3
Glyma03g00440.2Glyma03g00440.1Glyma16g34630.3Glyma16g34630.2Glyma16g34630.1
Glyma19g41090.1Glyma09g41000.1Glyma03g38490.1Glyma18g44810.1Glyma14g07930.1
Glyma19g41410.2Glyma17g37090.1Glyma09g35840.1Glyma01g37720.2Glyma12g01510.1
Glyma04g03270.1Glyma06g03350.1Glyma03g38840.1Glyma11g07580.1Glyma01g37720.1
Gossypium raimondiiGorai.005G201100.1Gorai.010G186400.2Gorai.013G075700.1Gorai.010G186400.1Gorai.011G124800.1
Gorai.010G186400.3Gorai.009G200500.2Gorai.009G200500.1Gorai.007G119100.1Gorai.007G119100.2
Gorai.005G120600.1Gorai.001G149200.1Gorai.007G119100.3
Linum usitatissimumLus10033687Lus10039833Lus10031650Lus10018598Lus10039032
Lus10027329Lus10014184Lus10014288Lus10025995Lus10007900
Lus10030347Lus10007210Lus10007211
Malus domesticaMDP0000322330MDP0000709705MDP0000417632MDP0000832632MDP0000321839
MDP0000120098MDP0000252855MDP0000281231MDP0000309661
Manihot esculentacassava4.1_008068mcassava4.1_027705mcassava4.1_006893mcassava4.1_008562mcassava4.1_025176m
cassava4.1_007999mcassava4.1_032265m
Medicago truncatulaMedtr4g078230.1Medtr8g005670.1Medtr8g005270.1Medtr7g111740.1Medtr5g020890.1
Medtr4g043760.1Medtr1g085310.1Medtr1g085350.1Medtr1g085320.1
Mimulus guttatusmgv1a007803mmgv1a005866mmgv1a005847mmgv1a006272mmgv1a025011m
mgv1a020287mmgv1a025294mmgv1a023976mmgv1a011066mmgv1a022814m
Oryza sativaLOC_Os01g54300.1LOC_Os06g20620.1LOC_Os12g02520.1LOC_Os02g52800.1LOC_Os01g47400.1
LOC_Os05g25480.1LOC_Os03g61280.2LOC_Os03g61280.1LOC_Os01g47400.2
Panicum virgatumPavirv00037971mPavirv00037189mPavirv00037030mPavirv00015019mPavirv00042163m
Pavirv00046651mPavirv00011599mPavirv00048102mPavirv00047147mPavirv00040471m
Pavirv00030867mPavirv00021810mPavirv00035248m
Physcomitrella patensPp1s180_63V6.1Pp1s41_160V6.1Pp1s23_181V6.2Pp1s429_16V6.1Pp1s22_64V6.1
Pp1s53_47V6.2Pp1s53_47V6.1Pp1s23_181V6.1Pp1s115_190V6.1Pp1s5_225V6.1
Pp1s83_137V6.1
Phaseolus vulgarisPhvul.004G108000.1Phvul.011G118900.1Phvul.010G058300.2Phvul.010G058300.1Phvul.008G081200.1
Phvul.001G219800.1Phvul.009G059700.1Phvul.002G033500.1Phvul.001G012600.1Phvul.001G223100.1
Picea abiesMA_10426380g0010MA_6558g0010MA_10427065g0010MA_58990g0010MA_894609g0010
MA_955078g0010MA_45718g0010MA_111906g0010MA_69814g0010MA_11130g0010
MA_110162g0010MA_953274g0010MA_38956g0010MA_10358593g0010MA_134938g0010
MA_10432193g0010MA_71720g0010
Populus trichocarpaPotri.013G130400.1Potri.006G009400.1Potri.016G138600.1Potri.006G109900.3Potri.016G138600.2
Potri.006G109900.2Potri.006G109900.1Potri.016G014800.1Potri.005G229600.3Potri.005G229600.2
Potri.005G229600.1Potri.005G120500.1Potri.007G022000.2Potri.007G022000.1Potri.002G184500.1
Prunus persicappa005783mppa006029mppa020168mppa005992mppa005849m
Ricinus communis29983.m00318529724.m00083229915.m00048630170.m01407330076.m004513
Setaria italicaSi006454mSi001340mSi019677mSi001544mSi010209m
Si024351mSi035445mSi027540m
Selaginella moellendorffii101148101525232427234867
Sorghum bicolorSb03g034420.1Sb10g011830.1Sb01g006080.1Sb04g034200.1Sb03g030340.1
Sb01g002630.1Sb05g001260.1
Thellungiella halophilaThhalv10025261mThhalv10001990mThhalv10013730mThhalv10020842mThhalv10004263m
Thhalv10007769m
Vitis viniferaGSVIVT01020553001GSVIVT01003344001GSVIVT01003349001GSVIVT01030163001GSVIVT01030165001
GSVIVT01009746001GSVIVT01037214001GSVIVT01037215001GSVIVT01037212001GSVIVT01037213001
GSVIVT01018923001GSVIVT01037211001GSVIVT01037216001
Volvox carteriVocar20006216m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)