y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G217900.1
FamilyGT33
Protein PropertiesLength: 477 Molecular Weight: 53403.8 Isoelectric Point: 6.7384
ChromosomeChromosome/Scaffold: 07 Start: 24771667 End: 24780470
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3364650
  RACVVVLGDLGRSPRMQYHALSLARQASLEVDIVAYGGSEPHSAVIENESIHIHTMIQWQKYSHSLPKIFYPLMLLLKPIIQFVILLWFLCFKVPHPDAF
  IVQNPPSVPTLVAVKWASSLRKSAFIVDWHNFGYTLLGLSVGRSSPFVSIYHWFEKHYGQMANGSLCVTRAMQHELAQNWGIRATVLYDQPPEFFCPTSL
  QEKHKLFCRLNRYLCHPLGVRDCVTATTTGIGADDQNETLFTTLVDTDILLKPNRPALVVSSTSWTPDEDFGILLEAAVMYDRRVAALLDENDSADEGVL
  WKEISGGKQYLYPRLLFIITGKGPEKEKYEEKIKRLNLKRVAFRTMWLSAEEYPLLLGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCAVSYSCIDEL
  VKVEKNGLLFSSSSELADELLMLFRGFPNECDALKSLKNGALETGSSARWATEWEEHAKP
Full Sequence
Protein Sequence     Length: 477     Download
MGKRGRACVV VLGDLGRSPR MQYHALSLAR QASLEVDIVA YGGSEPHSAV IENESIHIHT    60
MIQWQKYSHS LPKIFYPLML LLKPIIQFVI LLWFLCFKVP HPDAFIVQNP PSVPTLVAVK    120
WASSLRKSAF IVDWHNFGYT LLGLSVGRSS PFVSIYHWFE KHYGQMANGS LCVTRAMQHE    180
LAQNWGIRAT VLYDQPPEFF CPTSLQEKHK LFCRLNRYLC HPLGVRDCVT ATTTGIGADD    240
QNETLFTTLV DTDILLKPNR PALVVSSTSW TPDEDFGILL EAAVMYDRRV AALLDENDSA    300
DEGVLWKEIS GGKQYLYPRL LFIITGKGPE KEKYEEKIKR LNLKRVAFRT MWLSAEEYPL    360
LLGSADLGVC LHTSSSGLDL PMKVVDMFGC GLPVCAVSYS CIDELVKVEK NGLLFSSSSE    420
LADELLMLFR GFPNECDALK SLKNGALETG SSARWATEWE EHAKPLISEV ISRNLN*       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03794GT1_wbuB_like8.0e-7317428116+
TIGR00032argG2.0e-7315426113+
pfam13692Glyco_trans_1_42.0e-8260430171+
PLN02275PLN0227501429432+
cd03816GT1_ALG1_like02467468+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI19390.1014749482unnamed protein product [Vitis vinifera]
RefSeqNP_173105.1014731461glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002283369.101472124595PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330745.1014691467predicted protein [Populus trichocarpa]
RefSeqXP_002532170.1014761476beta1,4 mannosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
7496
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7940282372414770
DV1321852721253960
JG84984425712570
GO87265832733290
GO9217482672114770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_718_00001.2Aquca_095_00006.1.267.395Aquca_095_00006.1.10.256Aquca_095_00006.1.10.256Aquca_095_00006.2.10.256
Aquca_095_00006.2.10.256Aquca_095_00006.1.267.395Aquca_718_00001.1Aquca_060_00040.3Aquca_095_00006.2.267.381
Aquca_095_00006.2.267.381Aquca_060_00040.2Aquca_060_00040.1
Arabidopsis lyrata490368879948912013
Arabidopsis thalianaAT1G16570.1AT1G16570.2
Brachypodium distachyonBradi1g72620.1
Brassica rapaBra026714Bra026039
Carica papayaevm.model.supercontig_132.61
Capsella rubellaCarubv10009200mCarubv10008948m
Chlamydomonas reinhardtiiCre12.g516550.t1.2
Citrus clementinaCiclev10001033mCiclev10001025mCiclev10001005m
Citrus sinensisorange1.1g015058morange1.1g014316morange1.1g011690morange1.1g011969morange1.1g011979m
Cucumis sativusCucsa.034380.1
Eucalyptus grandisEucgr.F01412.2Eucgr.F01412.1
Fragaria vescamrna02356.1-v1.0-hybrid
Glycine maxGlyma15g40830.1Glyma15g40830.2Glyma08g18130.2
Gossypium raimondiiGorai.007G217600.1Gorai.007G217900.6Gorai.007G217900.3.324.433Gorai.007G217900.3.13.332Gorai.007G217900.7
Gorai.007G217900.3.13.332Gorai.006G005600.3.168.254Gorai.006G005600.3.168.254Gorai.007G217900.3.324.433Gorai.007G217900.5.326.428
Gorai.007G217900.5.326.428Gorai.006G005600.2.168.254Gorai.006G005600.2.168.254Gorai.006G005600.1.168.319Gorai.007G217900.4
Gorai.006G005600.1.168.319Gorai.007G217900.2
Linum usitatissimumLus10031569.147.292Lus10031569.147.292Lus10026065Lus10014357
Malus domesticaMDP0000161006.80.246MDP0000159170MDP0000159220MDP0000161006.80.246MDP0000161006.247.440
MDP0000161006.247.440
Manihot esculentacassava4.1_013829mcassava4.1_014658mcassava4.1_016683mcassava4.1_016689m
Medicago truncatulaMedtr2g069330.1
Mimulus guttatusmgv1a005765m
Oryza sativaLOC_Os03g08300.2LOC_Os03g08300.1LOC_Os06g36890.1
Panicum virgatumPavirv00056539mPavirv00038448m
Physcomitrella patensPp1s12_194V6.1
Phaseolus vulgarisPhvul.005G057900.1
Picea abiesMA_179056g0010
Populus trichocarpaPotri.001G394300.4Potri.001G394300.1Potri.001G394300.2Potri.001G394300.3
Prunus persicappa006637mppa005066mppa005033m
Ricinus communis27893.m000222
Setaria italicaSi035510m
Selaginella moellendorffii82712
Sorghum bicolorSb01g045200.1
Thellungiella halophilaThhalv10007520mThhalv10007572m
Vitis viniferaGSVIVT01009332001
Volvox carteriVocar20014254m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)