y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G217900.3
FamilyGT33
Protein PropertiesLength: 445 Molecular Weight: 49643.4 Isoelectric Point: 6.5032
ChromosomeChromosome/Scaffold: 07 Start: 24772030 End: 24779979
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT33133320
  RACVVVLGDLGRSPRMQYHALSLARQASLEVDIVAYGGSEPHSAVIENESIHIHTMIQWQKYSHSLPKIFYPLMLLLKPIIQFVILLWFLCFKVPHPDAF
  IVQNPPSVPTLVAVKWASSLRKSAFIVDWHNFGYTLLGLSVGRSSPFVSIYHWFEKHYGQMANGSLCVTRAMQHELAQNWGIRATVLYDQPPEFFCPTSL
  QEKHKLFCRLNRYLCHPLGVRDCVTATTTGIGADDQNETLFTTLVDTDILLKPNRPALVVSSTSWTPDEDFGILLEAAVMYDRRVAALLDENDSADEGVL
  WKEISGGKQYLYPRLLFIIT
GT333244330
  YPRLLFIITADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCAVSYSCIDELVKVEKNGLLFSSSSELADELLMLFRGFPNECDALKSLKNGALETGSSARW
  ATEWEEHAKP
Full Sequence
Protein Sequence     Length: 445     Download
MGKKEEKMGK RGRACVVVLG DLGRSPRMQY HALSLARQAS LEVDIVAYGG SEPHSAVIEN    60
ESIHIHTMIQ WQKYSHSLPK IFYPLMLLLK PIIQFVILLW FLCFKVPHPD AFIVQNPPSV    120
PTLVAVKWAS SLRKSAFIVD WHNFGYTLLG LSVGRSSPFV SIYHWFEKHY GQMANGSLCV    180
TRAMQHELAQ NWGIRATVLY DQPPEFFCPT SLQEKHKLFC RLNRYLCHPL GVRDCVTATT    240
TGIGADDQNE TLFTTLVDTD ILLKPNRPAL VVSSTSWTPD EDFGILLEAA VMYDRRVAAL    300
LDENDSADEG VLWKEISGGK QYLYPRLLFI ITADLGVCLH TSSSGLDLPM KVVDMFGCGL    360
PVCAVSYSCI DELVKVEKNG LLFSSSSELA DELLMLFRGF PNECDALKSL KNGALETGSS    420
ARWATEWEEH AKPLISEVIS RNLN*                                          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00032argG0.00235839437+
cd03801GT1_YqgM_like0.000328219201+
pfam13692Glyco_trans_1_43.0e-5267398140+
cd03816GT1_ALG1_like4.0e-17114435449+
PLN02275PLN02275014397426+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI19390.1024423482unnamed protein product [Vitis vinifera]
RefSeqNP_173105.1084411461glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002283369.102440118595PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330745.1084371467predicted protein [Populus trichocarpa]
RefSeqXP_002532170.1014441476beta1,4 mannosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
81103
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG849844251142640
GO872658320143330
DR940879269353030
DN941448262192800
JG576673253142660
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_718_00001.2Aquca_095_00006.1.267.395Aquca_095_00006.1.10.256Aquca_095_00006.1.10.256Aquca_095_00006.2.10.256
Aquca_095_00006.2.10.256Aquca_095_00006.1.267.395Aquca_718_00001.1Aquca_060_00040.3Aquca_095_00006.2.267.381
Aquca_095_00006.2.267.381Aquca_060_00040.2Aquca_060_00040.1
Arabidopsis lyrata490368879948912013
Arabidopsis thalianaAT1G16570.1AT1G16570.2
Brachypodium distachyonBradi1g72620.1
Brassica rapaBra026714Bra026039
Carica papayaevm.model.supercontig_132.61
Capsella rubellaCarubv10009200mCarubv10008948m
Chlamydomonas reinhardtiiCre12.g516550.t1.2
Citrus clementinaCiclev10001033mCiclev10001025mCiclev10001005m
Citrus sinensisorange1.1g015058morange1.1g014316morange1.1g011690morange1.1g011969morange1.1g011979m
Cucumis sativusCucsa.034380.1
Eucalyptus grandisEucgr.F01412.2Eucgr.F01412.1
Fragaria vescamrna02356.1-v1.0-hybrid
Glycine maxGlyma15g40830.1Glyma15g40830.2Glyma08g18130.2
Gossypium raimondiiGorai.007G217600.1Gorai.007G217900.6Gorai.007G217900.3.324.433Gorai.007G217900.3.13.332Gorai.007G217900.7
Gorai.007G217900.3.13.332Gorai.006G005600.3.168.254Gorai.006G005600.3.168.254Gorai.007G217900.3.324.433Gorai.007G217900.5.326.428
Gorai.007G217900.5.326.428Gorai.006G005600.2.168.254Gorai.006G005600.2.168.254Gorai.006G005600.1.168.319Gorai.007G217900.4
Gorai.006G005600.1.168.319Gorai.007G217900.1Gorai.007G217900.2
Linum usitatissimumLus10031569.147.292Lus10031569.147.292Lus10026065Lus10014357
Malus domesticaMDP0000161006.80.246MDP0000159170MDP0000159220MDP0000161006.80.246MDP0000161006.247.440
MDP0000161006.247.440
Manihot esculentacassava4.1_013829mcassava4.1_014658mcassava4.1_016683mcassava4.1_016689m
Medicago truncatulaMedtr2g069330.1
Mimulus guttatusmgv1a005765m
Oryza sativaLOC_Os03g08300.2LOC_Os03g08300.1LOC_Os06g36890.1
Panicum virgatumPavirv00056539mPavirv00038448m
Physcomitrella patensPp1s12_194V6.1
Phaseolus vulgarisPhvul.005G057900.1
Picea abiesMA_179056g0010
Populus trichocarpaPotri.001G394300.4Potri.001G394300.1Potri.001G394300.2Potri.001G394300.3
Prunus persicappa006637mppa005066mppa005033m
Ricinus communis27893.m000222
Setaria italicaSi035510m
Selaginella moellendorffii82712
Sorghum bicolorSb01g045200.1
Thellungiella halophilaThhalv10007520mThhalv10007572m
Vitis viniferaGSVIVT01009332001
Volvox carteriVocar20014254m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)