y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G217900.5
FamilyGT33
Protein PropertiesLength: 440 Molecular Weight: 48956.5 Isoelectric Point: 6.3871
ChromosomeChromosome/Scaffold: 07 Start: 24772825 End: 24779979
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3363260
  RACVVVLGDLGRSPRMQYHALSLARQASLEVDIVAYGGSEPHSAVIENESIHIHTMIQWQKYSHSLPKIFYPLMLLLKPIIQFVILLWFLCFKVPHPDAF
  IVQNPPSVPTLVAVKWASSLRKSAFIVDWHNFGYTLLGLSVGRSSPFVSIYHWFEKHYGQMANGSLCVTRAMQHELAQNWGIRATVLYDQPPEFFCPTSL
  QEKHKLFCRLNRYLCHPLGVRDCVTATTTGIGADDQNETLFTTLVDTDILLKPNRPALVVSSTSWTPDEDFGILLEAAVMYDRRVAALLDENDSADEGVL
  WKEISGGKQYLYPRLLFIITG
GT333264280
  GSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCAVSYSCIDELVKVEKNGLLFSSSSELADELLMLFRGFPNECDALKSLKNGALETGSSARWATEWEEH
  AKP
Full Sequence
Protein Sequence     Length: 440     Download
MGKRGRACVV VLGDLGRSPR MQYHALSLAR QASLEVDIVA YGGSEPHSAV IENESIHIHT    60
MIQWQKYSHS LPKIFYPLML LLKPIIQFVI LLWFLCFKVP HPDAFIVQNP PSVPTLVAVK    120
WASSLRKSAF IVDWHNFGYT LLGLSVGRSS PFVSIYHWFE KHYGQMANGS LCVTRAMQHE    180
LAQNWGIRAT VLYDQPPEFF CPTSLQEKHK LFCRLNRYLC HPLGVRDCVT ATTTGIGADD    240
QNETLFTTLV DTDILLKPNR PALVVSSTSW TPDEDFGILL EAAVMYDRRV AALLDENDSA    300
DEGVLWKEIS GGKQYLYPRL LFIITGSADL GVCLHTSSSG LDLPMKVVDM FGCGLPVCAV    360
SYSCIDELVK VEKNGLLFSS SSELADELLM LFRGFPNECD ALKSLKNGAL ETGSSARWAT    420
EWEEHAKPLI SEVISRNLN*                                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00032argG0.00235338937+
cd03801GT1_YqgM_like0.000321212201+
pfam13692Glyco_trans_1_42.0e-532739367+
cd03816GT1_ALG1_like5.0e-1762430456+
PLN02275PLN0227501392432+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI19390.1014379482unnamed protein product [Vitis vinifera]
RefSeqNP_173105.1014361461glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002283369.101435124595PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330745.1014321467predicted protein [Populus trichocarpa]
RefSeqXP_002532170.1014391476beta1,4 mannosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
7496
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG84984425712570
GO87265832633280
DR940879269282960
JG57667325732590
JZ01560424812480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_718_00001.2Aquca_095_00006.1.267.395Aquca_095_00006.1.10.256Aquca_095_00006.1.10.256Aquca_095_00006.2.10.256
Aquca_095_00006.2.10.256Aquca_095_00006.1.267.395Aquca_718_00001.1Aquca_060_00040.3Aquca_095_00006.2.267.381
Aquca_095_00006.2.267.381Aquca_060_00040.2Aquca_060_00040.1
Arabidopsis lyrata490368879948912013
Arabidopsis thalianaAT1G16570.1AT1G16570.2
Brachypodium distachyonBradi1g72620.1
Brassica rapaBra026714Bra026039
Carica papayaevm.model.supercontig_132.61
Capsella rubellaCarubv10009200mCarubv10008948m
Chlamydomonas reinhardtiiCre12.g516550.t1.2
Citrus clementinaCiclev10001033mCiclev10001025mCiclev10001005m
Citrus sinensisorange1.1g015058morange1.1g014316morange1.1g011690morange1.1g011969morange1.1g011979m
Cucumis sativusCucsa.034380.1
Eucalyptus grandisEucgr.F01412.2Eucgr.F01412.1
Fragaria vescamrna02356.1-v1.0-hybrid
Glycine maxGlyma15g40830.1Glyma15g40830.2Glyma08g18130.2
Gossypium raimondiiGorai.007G217600.1Gorai.007G217900.6Gorai.007G217900.3.324.433Gorai.007G217900.3.13.332Gorai.007G217900.7
Gorai.007G217900.3.13.332Gorai.006G005600.3.168.254Gorai.006G005600.3.168.254Gorai.007G217900.3.324.433Gorai.007G217900.5.326.428
Gorai.007G217900.5.326.428Gorai.006G005600.2.168.254Gorai.006G005600.2.168.254Gorai.006G005600.1.168.319Gorai.007G217900.4
Gorai.006G005600.1.168.319Gorai.007G217900.1Gorai.007G217900.2
Linum usitatissimumLus10031569.147.292Lus10031569.147.292Lus10026065Lus10014357
Malus domesticaMDP0000161006.80.246MDP0000159170MDP0000159220MDP0000161006.80.246MDP0000161006.247.440
MDP0000161006.247.440
Manihot esculentacassava4.1_013829mcassava4.1_014658mcassava4.1_016683mcassava4.1_016689m
Medicago truncatulaMedtr2g069330.1
Mimulus guttatusmgv1a005765m
Oryza sativaLOC_Os03g08300.2LOC_Os03g08300.1LOC_Os06g36890.1
Panicum virgatumPavirv00056539mPavirv00038448m
Physcomitrella patensPp1s12_194V6.1
Phaseolus vulgarisPhvul.005G057900.1
Picea abiesMA_179056g0010
Populus trichocarpaPotri.001G394300.4Potri.001G394300.1Potri.001G394300.2Potri.001G394300.3
Prunus persicappa006637mppa005066mppa005033m
Ricinus communis27893.m000222
Setaria italicaSi035510m
Selaginella moellendorffii82712
Sorghum bicolorSb01g045200.1
Thellungiella halophilaThhalv10007520mThhalv10007572m
Vitis viniferaGSVIVT01009332001
Volvox carteriVocar20014254m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)