y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G238800.3
FamilyAA2
Protein PropertiesLength: 200 Molecular Weight: 21787.7 Isoelectric Point: 9.8656
ChromosomeChromosome/Scaffold: 07 Start: 32592919 End: 32594205
Descriptionperoxidase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA291812.7e-29
  GGPTWKVPLGRRDSRTAHREGTGTIPTGHESLANIATLFKSMGLDSTDLVALSGVHTFGRARCAAFMDRLYNFNNVSGKIDPILNGTYAKTLRQLCPKGG
  DVTSLIDLDEQTSLTFDNKYFLNLQNRRGLLQTDQELFSTKGAETVAIVNRFASSQSQFFNSFAKAMIKMGNI
Full Sequence
Protein Sequence     Length: 200     Download
MSVFGLQGGG PTWKVPLGRR DSRTAHREGT GTIPTGHESL ANIATLFKSM GLDSTDLVAL    60
SGVHTFGRAR CAAFMDRLYN FNNVSGKIDP ILNGTYAKTL RQLCPKGGDV TSLIDLDEQT    120
SLTFDNKYFL NLQNRRGLLQ TDQELFSTKG AETVAIVNRF ASSQSQFFNS FAKAMIKMGN    180
INPLTGTNGE IRLDCRKTN*                                                240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like9.0e-121180201+
pfam00141peroxidase1.0e-1896557+
PLN03030PLN030301.0e-3810199194+
cd00693secretory_peroxidase2.0e-849198190+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PIR08199132318UP10_LACSN Unknown protein 10 from 2D-PAGE
GenBankAAQ67366.108199131322POD9 precursor [Gossypium hirsutum]
RefSeqXP_002285649.108199134325PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299145.108199132318predicted protein [Populus trichocarpa]
RefSeqXP_002530724.109199143333Peroxidase 53 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A08199113304A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1pa2_A08199113304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B09199115305A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB4a5g_A09199115305A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1gx2_B08199113306A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT467403188132000
DT465844183182000
FF40365117981860
JG85546817381800
DT462651173282000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00295.1Aquca_009_00126.1Aquca_007_00296.1Aquca_009_00240.1Aquca_010_00578.1
Aquca_010_00288.1Aquca_007_00480.1Aquca_022_00206.1Aquca_044_00082.1Aquca_002_01007.1
Arabidopsis lyrata480719487484910027915128891426
321537866489489772882539327109
489775323056326972485262485264
476012
Arabidopsis thalianaAT4G36430.1AT2G18150.1AT5G06720.1AT5G66390.1AT5G19890.1
AT4G16270.1AT5G06730.1AT2G18140.1AT1G44970.1AT2G38390.1
AT2G38380.1AT4G08770.1AT3G50990.1AT4G08780.1AT1G49570.1
AT5G19880.1AT3G32980.1AT3G49120.1AT3G49110.1AT2G35380.1
AT1G68850.1AT2G35380.2
Brachypodium distachyonBradi2g09660.1Bradi2g09680.1Bradi2g09690.1Bradi2g09650.1Bradi5g10070.1
Bradi2g40590.1Bradi1g68900.1Bradi1g43680.1Bradi1g27920.1Bradi1g68887.1
Bradi1g68927.1Bradi1g27910.1Bradi4g05230.1Bradi4g05190.1
Brassica rapaBra036330Bra039920Bra037176Bra009220Bra017761
Bra011683Bra011681Bra020072Bra009221Bra002271
Bra036842Bra000058Bra037877Bra017121Bra014200
Bra017120Bra002270Bra033551Bra012061Bra039816
Bra029933Bra000059Bra018006Bra018007Bra020071
Bra002269Bra004014Bra004343Bra005346Bra038345
Carica papayaevm.model.supercontig_6.180evm.model.supercontig_140.2evm.model.supercontig_119.100evm.model.supercontig_6.388evm.model.supercontig_119.99
evm.model.supercontig_119.98evm.model.supercontig_62.46evm.model.supercontig_9.35evm.model.supercontig_53.11evm.model.supercontig_1127.3
evm.model.supercontig_6.431
Capsella rubellaCarubv10015891mCarubv10005221mCarubv10016420mCarubv10027498mCarubv10011083m
Carubv10003822mCarubv10001380mCarubv10007253mCarubv10025052mCarubv10019275m
Carubv10001325mCarubv10001326mCarubv10009564mCarubv10016503mCarubv10017550m
Carubv10017534mCarubv10019421mCarubv10017532mCarubv10019462mCarubv10002844m
Carubv10025414mCarubv10020513m
Citrus clementinaCiclev10026054mCiclev10026130mCiclev10015779mCiclev10015783mCiclev10015790m
Ciclev10015793mCiclev10018160m
Citrus sinensisorange1.1g020149morange1.1g019976morange1.1g018873morange1.1g041231morange1.1g020050m
orange1.1g045752morange1.1g018847morange1.1g018796morange1.1g018871morange1.1g018764m
orange1.1g018855morange1.1g018811morange1.1g020451morange1.1g021592morange1.1g038520m
orange1.1g023510morange1.1g026183morange1.1g047796morange1.1g039981morange1.1g043984m
Cucumis sativusCucsa.201070.1Cucsa.043200.1Cucsa.153430.1Cucsa.247030.1Cucsa.313460.1
Cucsa.085290.1Cucsa.153470.1Cucsa.284220.1Cucsa.153470.2Cucsa.153430.2
Cucsa.153410.1Cucsa.153450.1Cucsa.153440.1Cucsa.129220.1Cucsa.153420.1
Cucsa.153400.1Cucsa.153390.1Cucsa.153390.2Cucsa.102290.1
Eucalyptus grandisEucgr.A02458.1Eucgr.H04063.1Eucgr.A02457.1Eucgr.A02459.1Eucgr.A02460.1
Eucgr.I01176.1Eucgr.D02157.1Eucgr.G02397.1Eucgr.B03091.1Eucgr.G02398.1
Eucgr.G01642.1
Fragaria vescamrna24405.1-v1.0-hybrid.25.296mrna24405.1-v1.0-hybrid.25.296mrna14926.1-v1.0-hybridmrna05067.1-v1.0-hybridmrna24083.1-v1.0-hybrid.340.611
mrna24083.1-v1.0-hybrid.340.611mrna31897.1-v1.0-hybridmrna24083.1-v1.0-hybrid.40.311mrna24083.1-v1.0-hybrid.40.311mrna15199.1-v1.0-hybrid
mrna04497.1-v1.0-hybridmrna24405.1-v1.0-hybrid.379.638mrna24405.1-v1.0-hybrid.379.638mrna10758.1-v1.0-hybrid
Glycine maxGlyma09g16810.1Glyma02g28880.1Glyma11g07670.1Glyma02g05930.1Glyma16g24610.1
Glyma01g37630.1Glyma19g33080.1Glyma13g16590.1Glyma17g06090.1Glyma14g07730.1
Glyma17g37240.1Glyma03g30180.1Glyma09g02670.1Glyma15g13510.1Glyma09g02610.1
Glyma15g13540.2Glyma15g13540.4Glyma15g13540.3Glyma15g13500.1Glyma09g02600.1
Glyma15g13550.2Glyma09g02680.1Glyma02g15290.1Glyma11g06180.1Glyma07g33180.1
Glyma01g39080.1Glyma15g13560.1Glyma17g06080.2Glyma17g06080.1Glyma09g02590.1
Glyma09g02650.1Glyma07g36580.1Glyma02g15280.1Glyma17g04030.1Glyma16g24640.1
Glyma15g13491.1Glyma09g07550.2Glyma01g40870.1Glyma17g20450.1Glyma01g40870.2.166.342
Glyma01g40870.2.166.342Glyma02g14090.1Glyma01g09650.1Glyma20g04430.2
Gossypium raimondiiGorai.007G049900.1Gorai.007G065200.1Gorai.007G199700.1Gorai.009G198700.1Gorai.006G143400.2
Gorai.006G143400.1Gorai.004G093000.1Gorai.005G068200.1Gorai.004G093200.2Gorai.010G127400.1
Gorai.004G093200.1Gorai.012G150400.1Gorai.007G070800.1Gorai.004G093200.4Gorai.007G238800.4
Gorai.007G238800.2Gorai.007G238800.1Gorai.004G265900.2Gorai.004G265900.1Gorai.008G228500.1
Gorai.008G073800.1Gorai.008G174200.1Gorai.005G148900.1
Linum usitatissimumLus10041784Lus10027989Lus10010634Lus10004163Lus10008167
Lus10025535Lus10026748Lus10029094Lus10013065Lus10008168
Lus10008173Lus10020994Lus10027984Lus10027983Lus10017069
Lus10008174Lus10027988Lus10009901Lus10028337Lus10040107
Lus10023858Lus10037786
Malus domesticaMDP0000151864MDP0000312095MDP0000138382MDP0000301828MDP0000245389
MDP0000208152MDP0000706473MDP0000448302MDP0000567775MDP0000215414
MDP0000211003MDP0000233961MDP0000611163MDP0000539299MDP0000208213
MDP0000300218MDP0000727958MDP0000305310MDP0000612477MDP0000581957
MDP0000304104MDP0000292921MDP0000264098
Manihot esculentacassava4.1_011574mcassava4.1_024428mcassava4.1_011738mcassava4.1_032435mcassava4.1_030233m
cassava4.1_023402mcassava4.1_011305mcassava4.1_030160mcassava4.1_011844mcassava4.1_021987m
cassava4.1_011142mcassava4.1_021175mcassava4.1_031396mcassava4.1_013283m
Medicago truncatulaMedtr5g021060.2Medtr8g076820.1Medtr5g021060.1Medtr7g093370.1Medtr2g040000.1
Medtr2g028980.1Medtr2g029740.1Medtr2g029800.2Medtr2g029820.1.136.404Medtr2g029820.1.136.404
Medtr2g029830.1Medtr2g029860.1Medtr2g029820.1.504.772Medtr2g029820.1.504.772Medtr2g029850.1
Medtr2g029750.1Medtr2g029800.1Medtr2g029730.1Medtr1g022970.1AC235668_11.1
Medtr4g122640.1Medtr2g029910.1Medtr5g017850.1Medtr5g017860.1Medtr5g014100.1
Medtr2g029880.1
Mimulus guttatusmgv1a009418mmgv1a009720mmgv1a008931mmgv1a018276mmgv1a009598m
mgv1a018146mmgv1a025866mmgv1a021857mmgv1a024365mmgv1a022021m
Oryza sativaLOC_Os01g15830.1LOC_Os01g36240.1LOC_Os01g15810.1LOC_Os03g13200.1LOC_Os03g13180.1
LOC_Os10g02040.1LOC_Os08g20730.1LOC_Os03g13210.1LOC_Os04g34630.1LOC_Os10g02070.1
LOC_Os06g16350.1
Panicum virgatumPavirv00034835mPavirv00047181mPavirv00048026mPavirv00049606mPavirv00006152m
Pavirv00012630mPavirv00007643mPavirv00049834mPavirv00020708mPavirv00065495m
Pavirv00062710mPavirv00009688mPavirv00060031mPavirv00051769mPavirv00019242m
Pavirv00042223mPavirv00047761mPavirv00012193mPavirv00035893mPavirv00031060m
Pavirv00068439mPavirv00012678mPavirv00052454mPavirv00020296mPavirv00022434m
Pavirv00032381mPavirv00036815mPavirv00022557mPavirv00036818mPavirv00031413m
Pavirv00036817mPavirv00015555mPavirv00056292m
Physcomitrella patensPp1s60_86V6.1Pp1s112_96V6.1
Phaseolus vulgarisPhvul.007G260800.1Phvul.007G260700.1Phvul.001G143300.1Phvul.002G166300.1Phvul.003G257400.1
Phvul.001G011300.1Phvul.006G130000.1Phvul.006G129500.1Phvul.006G129600.1Phvul.006G129900.1
Phvul.003G134600.1Phvul.006G129700.1Phvul.006G129400.1Phvul.003G294000.1Phvul.002G020900.1
Phvul.006G129200.1Phvul.006G129300.1Phvul.006G129800.1Phvul.003G117000.1Phvul.006G130100.1
Phvul.002G005400.1Phvul.002G082100.1Phvul.003G117000.2Phvul.002G005400.2
Picea abiesMA_10227622g0010MA_140596g0010MA_125040g0020MA_10431332g0010MA_20223g0020
MA_10428648g0010MA_109058g0010MA_179122g0010MA_108425g0010MA_10434028g0020
MA_8074461g0010MA_147662g0020MA_111431g0010MA_45356g0010MA_3486g0010
MA_235485g0010MA_10425995g0010MA_120762g0010MA_58726g0010MA_195775g0010
MA_166754g0010MA_10436483g0010.48.237MA_10436483g0010.48.237MA_8977627g0010
Populus trichocarpaPotri.007G019300.1Potri.005G118700.1Potri.003G214500.1Potri.003G214800.1Potri.003G214700.1
Potri.016G058200.1Potri.003G214900.1Potri.001G011200.1Potri.002G031200.1Potri.005G135300.1
Potri.001G011300.1Potri.001G013000.1Potri.008G103200.1Potri.001G011000.1Potri.001G145800.1
Potri.004G144600.1Potri.009G106400.1Potri.016G058800.1Potri.003G215000.1Potri.001G011500.1
Potri.008G110600.1Potri.010G134500.1
Prunus persicappa008390mppa008349mppa007826mppa007654mppb006944m
ppa019052mppa020321mppa008504mppa008433mppa008309m
ppa027053mppa023946mppa008666mppa023689m
Ricinus communis29634.m00206729613.m00038030170.m01409529780.m00132729889.m003322
28295.m00001428691.m00003529676.m00162930054.m00079130138.m003856
Setaria italicaSi002124mSi002126mSi002156mSi002134mSi036541m
Si002053mSi036119mSi007943mSi036449mSi036496m
Si036619mSi036480mSi002076mSi036462mSi036487m
Si036602mSi022700mSi022693mSi022667mSi040875m
Selaginella moellendorffii230146126833235371235372430498
23682222982827135018230396952
91394
Sorghum bicolorSb03g010240.1Sb03g010250.1Sb03g024460.1Sb03g010230.1Sb01g041790.1
Sb01g041770.1Sb01g027330.1Sb06g016610.1Sb07g010450.1Sb01g041760.1
Sb01g020830.1Sb10g010040.1Sb09g020980.1Sb09g021000.1Sb09g020970.1
Sb09g020960.1Sb09g021040.1Sb09g021050.1Sb09g021030.1
Thellungiella halophilaThhalv10022774mThhalv10011616mThhalv10004548mThhalv10014029mThhalv10025683m
Thhalv10013916mThhalv10014080mThhalv10025534mThhalv10016868mThhalv10011077m
Thhalv10011619mThhalv10022759mThhalv10010494mThhalv10028769mThhalv10014083m
Thhalv10016025mThhalv10018830mThhalv10000286mThhalv10016900m
Vitis viniferaGSVIVT01033484001GSVIVT01025373001GSVIVT01034967001GSVIVT01031801001GSVIVT01013238001
GSVIVT01018865001GSVIVT01007448001GSVIVT01010168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)