y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G245600.1
FamilyCE11
Protein PropertiesLength: 148 Molecular Weight: 16464.7 Isoelectric Point: 6.5017
ChromosomeChromosome/Scaffold: 07 Start: 36975668 End: 36977402
DescriptionUDP-3-O-acyl N-acetylglycosamine deacetylase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE11251141.8e-27
  QQTLTGCIELSGKTRQSGKVSKVKIWPGFTSQGRYFEFHSNLIPASIDFVRESLLCTSLCKDGYKIRTVEHLLSALEAKGIDNCRIQIQS
Full Sequence
Protein Sequence     Length: 148     Download
MRLSATINSF KSSNLISWKT TGKLQQTLTG CIELSGKTRQ SGKVSKVKIW PGFTSQGRYF    60
EFHSNLIPAS IDFVRESLLC TSLCKDGYKI RTVEHLLSAL EAKGIDNCRI QIQSLDSEDT    120
EVEGLWDVEN DNDGQQEGCV LRVISQF*                                       180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13188PRK131884.0e-122511294+
TIGR00325lpxC2.0e-172511293+
COG0774LpxC5.0e-182411295+
pfam03331LpxC3.0e-192511293+
PRK13186lpxC2.0e-212511494+
Gene Ontology
GO TermDescription
GO:0008759UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26831.1011231123unnamed protein product [Vitis vinifera]
RefSeqNP_001117351.17e-4011231137UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana]
RefSeqNP_173874.24e-3911231137UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana]
RefSeqNP_173884.57e-39112344180UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana]
RefSeqXP_002281269.1011231123PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4fw7_D0.0000001251147100B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB4fw7_C0.0000001251147100B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB4fw7_B0.0000001251147100B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB4fw7_A0.0000001251147100B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB4fw6_D0.0000001251147100B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BE05397112311230
BQ40553111771230
CU58589412131230
GW93224211861230
GW83153812131230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00088.3Aquca_091_00088.2Aquca_091_00088.1
Arabidopsis lyrata472870
Arabidopsis thalianaAT1G25054.1AT1G24793.2AT1G25210.2AT1G24793.1AT1G24880.1
AT1G25054.2AT1G25145.1AT1G25210.1
Brachypodium distachyonBradi1g69490.1
Brassica rapaBra010979
Carica papayaevm.model.supercontig_2.193
Capsella rubellaCarubv10009664m
Chlamydomonas reinhardtiiCre16.g653350.t1.2
Citrus clementinaCiclev10015996mCiclev10015964m
Citrus sinensisorange1.1g042138m
Cucumis sativusCucsa.188640.1Cucsa.188650.1
Eucalyptus grandisEucgr.B02675.2Eucgr.B02675.1
Glycine maxGlyma02g09350.1
Gossypium raimondiiGorai.002G172000.4Gorai.002G172000.5Gorai.002G172000.3Gorai.002G172000.1Gorai.002G172000.2
Gorai.002G172000.6Gorai.001G151600.1Gorai.010G050600.1Gorai.005G149500.1Gorai.005G145500.1
Gorai.009G391300.3Gorai.009G391300.2Gorai.009G391300.1
Linum usitatissimumLus10003708Lus10001592
Malus domesticaMDP0000319902MDP0000264715MDP0000150490
Manihot esculentacassava4.1_012733m
Mimulus guttatusmgv1a025203m
Oryza sativaLOC_Os03g12320.3LOC_Os03g12320.2LOC_Os03g12320.1
Panicum virgatumPavirv00014435mPavirv00025226m
Physcomitrella patensPp1s1_376V6.1
Phaseolus vulgarisPhvul.003G019200.2Phvul.003G019200.1
Picea abiesMA_159099g0220MA_10433938g0010
Populus trichocarpaPotri.010G106400.1Potri.010G106400.2Potri.T177300.1Potri.010G106400.3
Prunus persicappa009014m
Ricinus communis29673.m000948
Setaria italicaSi036592mSi010565mSi036620m
Selaginella moellendorffii117127
Sorghum bicolorSb01g042410.1
Thellungiella halophilaThhalv10007963m
Vitis viniferaGSVIVT01011660001
Volvox carteriVocar20012425m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny