y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G271100.1
FamilyGT41
Protein PropertiesLength: 964 Molecular Weight: 108430 Isoelectric Point: 6.8881
ChromosomeChromosome/Scaffold: 07 Start: 45536705 End: 45545043
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT417439450
  HKRSDYGLPEDKFIFACFNQLYKMDPEIFNTWCNILKRVPNSALWLLRFPAAGETRLRAYAAAQGVQPEQIIFTDVAMKHEHIRRSALADLCLDTPLCNA
  HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVNSMKEYEERAVSLALNRLKLQALTNKLKAARLTCPLFDTARWVRNLERSYFKMWNLYC
  SGQ
Full Sequence
Protein Sequence     Length: 964     Download
MLSMNNGVTI SRDSTYGGSV VDRTDVISDA PALASGKASI YGAKHEPASS LGIVPHRGPD    60
SLEVDEDMQL ALAHQLYKSG NYKQALDHSN AVYDQNSLRT DNLLLLGAIY YQLHDYDMCI    120
AKNEEALRIQ PRFAECYGNM ANAWKEKGDV DVAIRYYMIA IELRPNFADA WSNLASAYMR    180
KRRFNEAAQC CRQALQLNPL LVDAHSNLGN LMKAQGLAQE AYSCYLEALR IQPTFAIAWS    240
NLAGLFMDSG DLNRALQYYK EAVKLKPAFP EAYLNLGNIY KALAMPQEAI VCYQRAVQTR    300
PNYPVALGNL ASTYYERGQL DLAIHHYKQA IAYDQRFVEA YNNLGNALKD VGRVDEAIQC    360
YNQCLTLQPN HPQALTNLGN IYMEWNMVGA AASYYKATLA VTTGLSAPFN NLAVIYKQQG    420
NHMEAISCYN EVLRIDPLAA DGLVNRGNTY KEIGRVSEAI QDYICAINIQ PNMAEAHANL    480
ASAYKDSGHV EAAVKSYKQA LLLRPDFPEA TCNLLHTLQC VCCWEDRDKM FTEVEGIIRR    540
QINMSVLPSV QPFHAIAYPI DPMLALDISR KYAAHCSLIA SRFALPPFNH PAPIPIKQDC    600
GNQRLKIGYV FCYALSQNDG TEWRQRIQSE AEHFIDVSSM SSDVIAKMIN KDGIQILINL    660
NGYTKGARNE IFAMQPAPIQ VSYMGFPGTT GADYIDYLVS DEFVSPLRYA HIYSEKLVHL    720
PHCYFVNDYK QKNRDVLDPH CQHKRSDYGL PEDKFIFACF NQLYKMDPEI FNTWCNILKR    780
VPNSALWLLR FPAAGETRLR AYAAAQGVQP EQIIFTDVAM KHEHIRRSAL ADLCLDTPLC    840
NAHTTGTDVL WAGLPMVTLP LEKMATRVAG SLCLATGLGE EMIVNSMKEY EERAVSLALN    900
RLKLQALTNK LKAARLTCPL FDTARWVRNL ERSYFKMWNL YCSGQQPQHF KVTENDFDFP    960
YNR*                                                                 1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_413.0e-77745938194+
COG3914Spy3.0e-89410941573+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187074.106396350977SEC (secret agent); transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002270163.103996338986PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319130.10659601923predicted protein [Populus trichocarpa]
RefSeqXP_002325368.101189631873predicted protein [Populus trichocarpa]
RefSeqXP_002522031.10279634979o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03697446400A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB4gz6_D0745950514718A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB4gz6_D1e-281312786153A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB4gz6_D7e-251993516158A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB4gz6_D8e-241653116152A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7952474635299640
HO7787254505429640
HO798232443314730
HO7982323671395050
HO795247524795302e-21
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.334.533Aquca_058_00216.4.334.533Aquca_058_00216.3.560.759Aquca_058_00216.3.560.759Aquca_058_00216.1.773.973
Aquca_058_00216.1.773.973
Arabidopsis lyrata896453.754.961896453.754.961
Arabidopsis thalianaAT3G04240.1.754.961AT3G04240.1.754.961
Brachypodium distachyonBradi3g43577.3.780.979Bradi3g43577.3.780.979Bradi5g06647.1.792.998Bradi5g06647.1.792.998Bradi2g58616.1.761.965
Bradi2g58616.1.761.965
Brassica rapaBra040144.752.961Bra040144.752.961
Carica papayaevm.model.supercontig_51.46.533.743evm.model.supercontig_51.46.533.743
Capsella rubellaCarubv10012900m.754.955Carubv10012900m.754.955
Citrus clementinaCiclev10018711m.753.949Ciclev10018711m.753.949
Citrus sinensisorange1.1g003557m.591.791orange1.1g003557m.591.791orange1.1g002431m.702.902orange1.1g002431m.702.902orange1.1g002729m.702.886
orange1.1g002729m.702.886
Cucumis sativusCucsa.027630.1.766.964Cucsa.027630.1.766.964
Eucalyptus grandisEucgr.L00641.1.730.929Eucgr.L00641.1.730.929
Fragaria vescamrna16720.1-v1.0-hybrid.753.952mrna16720.1-v1.0-hybrid.753.952
Glycine maxGlyma10g31190.1.767.969Glyma10g31190.1.767.969Glyma20g36330.1.767.969Glyma20g36330.1.767.969
Gossypium raimondiiGorai.013G189100.3.575.778Gorai.013G189100.3.575.778Gorai.013G189100.1.770.972Gorai.013G189100.1.770.972Gorai.011G150500.5.705.913
Gorai.011G150500.5.705.913Gorai.011G150500.4.705.913Gorai.011G150500.4.705.913Gorai.011G150500.2.778.986Gorai.011G150500.2.778.986
Gorai.011G150500.1.784.992Gorai.011G150500.1.784.992Gorai.007G271100.2Gorai.013G189100.2.770.954Gorai.013G189100.2.770.954
Linum usitatissimumLus10003576.755.956Lus10003576.755.956Lus10004779.756.956Lus10004779.756.956Lus10003113.756.956
Lus10003113.756.956
Malus domesticaMDP0000233292.759.959MDP0000233292.759.959
Manihot esculentacassava4.1_001015m.753.953cassava4.1_001015m.753.953cassava4.1_002695m.485.686cassava4.1_002695m.485.686cassava4.1_002691m.485.686
cassava4.1_002691m.485.686cassava4.1_001021m.752.953cassava4.1_001021m.752.953
Medicago truncatulaMedtr1g079510.2.521.726Medtr1g079510.2.521.726Medtr1g079510.1.763.967Medtr1g079510.1.763.967
Mimulus guttatusmgv1a000777m.768.972mgv1a000777m.768.972mgv1a000982m.703.906mgv1a000982m.703.906
Oryza sativaLOC_Os02g28830.1.426.628LOC_Os02g28830.1.426.628LOC_Os01g68680.1.758.959LOC_Os01g68680.1.758.959
Panicum virgatumPavirv00063187m.788.989Pavirv00063187m.788.989Pavirv00016961m
Physcomitrella patensPp1s177_132V6.1.776.975Pp1s177_132V6.1.776.975Pp1s263_4V6.1.778.976Pp1s263_4V6.1.778.976
Phaseolus vulgarisPhvul.007G119800.1.768.970Phvul.007G119800.1.768.970
Picea abiesMA_247226g0010.480.681MA_247226g0010.480.681MA_76964g0020.545.746MA_76964g0020.545.746
Populus trichocarpaPotri.013G051400.7.383.584Potri.013G051400.7.383.584Potri.013G051400.6.524.724Potri.013G051400.6.524.724Potri.013G051400.2.763.963
Potri.013G051400.2.763.963Potri.019G025600.6.390.588Potri.019G025600.6.390.588Potri.019G025600.5.526.724Potri.019G025600.5.526.724
Potri.019G025600.4.594.792Potri.019G025600.4.594.792Potri.019G025600.3.655.853Potri.019G025600.3.655.853Potri.019G025600.2.761.959
Potri.019G025600.2.761.959Potri.019G025600.1.761.959Potri.019G025600.1.761.959Potri.013G051400.1.763.964Potri.013G051400.1.763.964
Potri.013G051400.3.763.961Potri.013G051400.3.763.961Potri.013G051400.4.763.947Potri.013G051400.4.763.947
Prunus persicappa000862m.759.959ppa000862m.759.959
Ricinus communis29680.m001749.759.96029680.m001749.759.96039707.m00001532488.m000020
Setaria italicaSi016197m.790.991Si016197m.790.991Si000265m.652.855Si000265m.652.855
Selaginella moellendorffii143846.655.856143846.655.856
Sorghum bicolorSb04g019560.1.790.998Sb04g019560.1.790.998
Thellungiella halophilaThhalv10019996m.754.959Thhalv10019996m.754.959Thhalv10020000m.729.933Thhalv10020000m.729.933
Vitis viniferaGSVIVT01026359001.766.967GSVIVT01026359001.766.967
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny