y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G297200.1
FamilyGH2
Protein PropertiesLength: 970 Molecular Weight: 110251 Isoelectric Point: 5.6827
ChromosomeChromosome/Scaffold: 07 Start: 50737042 End: 50743499
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2377260
  PSSPWMEAVVPGTVLATLVKNKVVADPFYGLENEMIIDIADSGREYYKFWFFTKFQCKLSGAQHLDLNFRAINYSAEVYLNGHKMVLPKGMFRRHSLEVT
  DILNPDGENLLAVLVHPPDHPGRIPPEGGQGGDHEIGKDVATQYVEGWDWIAPVRDRNTGIWDEVSISVTGPVKIIDPHLVSSFFDQYTRAYLHATTELE
  NRSAWVADCSLNIQVATELEGSVCLIEHLQTQHVSVPPGARIQYTFPKLSFYKPNLWWPNGLGKQSLYNVSITVDVKGYGESDTWGHLFGFRKIESHIDR
  ATGGRLFKVNGQPIFIRGGNWILSDCLLRLSKERYKTDIKFHADMNLNMIRCWGGGLAERPEFYHYCDVYGLLVWQEFWITGDVDGRGIPISNPDGPLDH
  DLFMLCARDTVKLLRNYPSLALWVGGNEQVPPDDINTALKNDLKLHPLFESHSENALSIEEEDPSQYLDGTRVYIQGSMWDGFANGKGDFTDGPYEIQNP
  EDFFKDNFYNYGFNPEVGSVGMPVAATIRATMPPKGWQIPLFKKLTNGYTEEVPNPIWEYHKYIPYSKPGKVHDQIELYGIPKDLDDFCLKAQLVNYVQY
  RALLEGWTSRMWSKYTGVLIWKTQNPWSGLRGQFYDYLLDQTAGFYGCRCAAEPIHVQLNLATYFIEVVNTTSEELSNVAVEASVWDLEG
Full Sequence
Protein Sequence     Length: 970     Download
MAEIGKTLLE SGWLAARSTE VELTGSQLTT THPPTGPSSP WMEAVVPGTV LATLVKNKVV    60
ADPFYGLENE MIIDIADSGR EYYKFWFFTK FQCKLSGAQH LDLNFRAINY SAEVYLNGHK    120
MVLPKGMFRR HSLEVTDILN PDGENLLAVL VHPPDHPGRI PPEGGQGGDH EIGKDVATQY    180
VEGWDWIAPV RDRNTGIWDE VSISVTGPVK IIDPHLVSSF FDQYTRAYLH ATTELENRSA    240
WVADCSLNIQ VATELEGSVC LIEHLQTQHV SVPPGARIQY TFPKLSFYKP NLWWPNGLGK    300
QSLYNVSITV DVKGYGESDT WGHLFGFRKI ESHIDRATGG RLFKVNGQPI FIRGGNWILS    360
DCLLRLSKER YKTDIKFHAD MNLNMIRCWG GGLAERPEFY HYCDVYGLLV WQEFWITGDV    420
DGRGIPISNP DGPLDHDLFM LCARDTVKLL RNYPSLALWV GGNEQVPPDD INTALKNDLK    480
LHPLFESHSE NALSIEEEDP SQYLDGTRVY IQGSMWDGFA NGKGDFTDGP YEIQNPEDFF    540
KDNFYNYGFN PEVGSVGMPV AATIRATMPP KGWQIPLFKK LTNGYTEEVP NPIWEYHKYI    600
PYSKPGKVHD QIELYGIPKD LDDFCLKAQL VNYVQYRALL EGWTSRMWSK YTGVLIWKTQ    660
NPWSGLRGQF YDYLLDQTAG FYGCRCAAEP IHVQLNLATY FIEVVNTTSE ELSNVAVEAS    720
VWDLEGACPS YNVFDKLSLP PKKVMSISEL NHPKSENPKP VYFLLLKLYN MSNNSIISRN    780
FYWLYLPGGD YKLLEPYRNK RIPLQITSKT SHKDSSYEIE MNVQNKSEKP DPKILTYKNK    840
FANRREDGEF DMSSLEPIHD KTEEKQKAGL FQRLYRQFPR ETDGSKITEI KGSDVGVVFF    900
LKFSVHALKT DNKGGEDTRI LPVHYSDNYF SLVPGEEMSI KMSFEVPQGV TPRVTLEGWN    960
YQSEVHTVI*                                                           1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK09525lacZ6.0e-5193464306+
pfam02837Glyco_hydro_2_N3.0e-510316159+
pfam00703Glyco_hydro_24.0e-8209328120+
PRK10340ebgA7.0e-15113464367+
COG3250LacZ4.0e-3443464431+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAO27794.1019691976glycosyl hydrolase [Gossypium hirsutum]
EMBLCAN82620.1019641969hypothetical protein [Vitis vinifera]
RefSeqXP_002284576.1019641969PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319539.1019631968predicted protein [Populus trichocarpa]
RefSeqXP_002512381.1019621967beta-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vzo_B03478474767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzo_A03478474767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2x09_B03478474767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7939203673727360
ES8327903644878500
ES8188072921604510
CO1254532766198940
ES8188071324395540.00002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brachypodium distachyonBradi2g26600.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.2Eucgr.H04490.1Eucgr.H04490.3
Fragaria vescamrna22540.1-v1.0-hybrid
Glycine maxGlyma10g29550.1Glyma20g37760.1Glyma03g39810.1Glyma19g42370.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000300462MDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1Phvul.006G092100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny