y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G332800.1
FamilyGT48
Protein PropertiesLength: 307 Molecular Weight: 35622.9 Isoelectric Point: 9.7626
ChromosomeChromosome/Scaffold: 07 Start: 55551267 End: 55552930
Descriptionglucan synthase-like 4
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4812970
  MLSCYFTTIGFYFSSLISVLGIYVFLYGQLYLVLSGLEKALLIEARMKNTESLETALASQSFIQLGLLTGLPMVMEIGLEKGFLTALKDFVLMQLQFAAV
  FFTFSLGTKTHHFGRTIMYGGAKYIPTGRKVVVFHASFTENYRLYSRSHFVKGFELLLLLVVYDLFRRSYQSSMAYVLITYSVWFMTMTWLFAPFLFNPS
  GFDWDKIVDDWKGWNKWIKEKGGIGIQQNKSWQSWWNDEQAHLRRSGYGARLFEILLSIRFFLYQYGLVYHLDISQQSKNFLVYMLSWVVILAVFLT
Full Sequence
Protein Sequence     Length: 307     Download
MLSCYFTTIG FYFSSLISVL GIYVFLYGQL YLVLSGLEKA LLIEARMKNT ESLETALASQ    60
SFIQLGLLTG LPMVMEIGLE KGFLTALKDF VLMQLQFAAV FFTFSLGTKT HHFGRTIMYG    120
GAKYIPTGRK VVVFHASFTE NYRLYSRSHF VKGFELLLLL VVYDLFRRSY QSSMAYVLIT    180
YSVWFMTMTW LFAPFLFNPS GFDWDKIVDD WKGWNKWIKE KGGIGIQQNK SWQSWWNDEQ    240
AHLRRSGYGA RLFEILLSIR FFLYQYGLVY HLDISQQSKN FLVYMLSWVV ILAVFLTVKV    300
KFIQVS*                                                              360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02364Glucan_synthase2.0e-491295333+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB02389.10127815361813glucan synthase-like protein [Arabidopsis thaliana]
RefSeqNP_188075.10127815371814ATGSL04 (glucan synthase-like 4); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Swiss-ProtQ9LUD70127815401817CALS8_ARATH RecName: Full=Putative callose synthase 8; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 4
RefSeqXP_002451859.101280107386hypothetical protein SORBIDRAFT_04g008830 [Sorghum bicolor]
RefSeqXP_002530134.10128114511731transferase, transferring glycosyl groups, putative [Ricinus communis]
Transmembrane Domains
StartEnd
527
90108
175197
281303
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT689151229162440
CU53944321112110
JG90231725612560
GO876767264373000
FL920266274262990
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_50.99
Citrus clementinaCiclev10015387m
Glycine maxGlyma12g12750.1
Linum usitatissimumLus10000830Lus10014601
Malus domesticaMDP0000542728MDP0000624875MDP0000695519MDP0000138855
Manihot esculentacassava4.1_007052m
Oryza sativaLOC_Os06g02260.2LOC_Os06g02260.1
Panicum virgatumPavirv00049629mPavirv00005035mPavirv00035379mPavirv00002017mPavirv00014599m
Pavirv00001511m
Phaseolus vulgarisPhvul.009G169500.1
Picea abiesMA_40978g0030MA_111976g0010MA_10432652g0010MA_8263680g0010MA_10437131g0040
Setaria italicaSi032541m
Selaginella moellendorffii427055
Sorghum bicolorSb01g049270.1Sb01g050470.1
Thellungiella halophilaThhalv10029468m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny