y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G367900.1
FamilyGT41
Protein PropertiesLength: 927 Molecular Weight: 103096 Isoelectric Point: 5.4037
ChromosomeChromosome/Scaffold: 07 Start: 60031459 End: 60039990
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT413988520
  PTYAEAYNNLGVLYRDAGNISMAITAYEQCLKIDPDSRNAGQNRLLAMNYISEGDDKLFDAHRDWGRRFMRLYSQYNSWDNPKDPERPLVIGYISPDYFT
  HSVSYFIEAPLIYHDYRNYHVVVYSAVVKADAKTIRFREKVLKRGGVWRDIYGIDEKKVASMVRDDKIDILVELTGHTANNKLGTMACRPAPIQVTWIGY
  PNTTGLPTIDYRITDSFADPPDTKQKHVEELVRLPECFLCYTPSPEAGPVSPTPALANGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFC
  CDSVRQKFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLSKVGLQHLIARNEDEYV
  QLALKLASDITALQNLRTSLRDLMSKSPVCDGQNFISGLEATYRNIWRRYCKDDV
Full Sequence
Protein Sequence     Length: 927     Download
MAWTVKDVNE RDKDLVVENG FVKEPKSSPG SSVSTADVIP SQKALEGKDS LSYANILRSR    60
NKFADALAIY NDVLEKDSGC IEAHIGKGIC LQMQNMGGPA FESFSEAIKL DPQNACALTH    120
CGILYKDEGR LVDAAESYQK ALSADPSYKP AAECLAIVLT DLGTSLKLAG NTQEGIQKYY    180
EALKIDSHYA PAYYNLGVVY SEMMQYDTAL SCYEKAALER PMYAEAYCNM GVIYKNRGDL    240
ESAIACYERC LAVSPNFEIA KNNMAIALTD LGTKVKLEGD INEGVAYYKK ALSYNWHYAD    300
AMYNLGVAYG EMLKFDMAVV YYELAFHFNP HCAEACNNLG VIYKDRDNLD KAVECYQLAL    360
SIKPNFSQSL NNLGVVYTVQ GKMDAAASMI EKAIIACPTY AEAYNNLGVL YRDAGNISMA    420
ITAYEQCLKI DPDSRNAGQN RLLAMNYISE GDDKLFDAHR DWGRRFMRLY SQYNSWDNPK    480
DPERPLVIGY ISPDYFTHSV SYFIEAPLIY HDYRNYHVVV YSAVVKADAK TIRFREKVLK    540
RGGVWRDIYG IDEKKVASMV RDDKIDILVE LTGHTANNKL GTMACRPAPI QVTWIGYPNT    600
TGLPTIDYRI TDSFADPPDT KQKHVEELVR LPECFLCYTP SPEAGPVSPT PALANGFITF    660
GSFNNLAKIT PKVLQVWARI LCAVPNSRLV VKCKPFCCDS VRQKFLSTLE QLGLESLRVD    720
LLPLILLNHD HMQAYSLMDI SLDTFPYAGT TTTCESLYMG VPCVTMAGSV HAHNVGVSLL    780
SKVGLQHLIA RNEDEYVQLA LKLASDITAL QNLRTSLRDL MSKSPVCDGQ NFISGLEATY    840
RNIWRRYCKD DVPSLRYMET LQKQDIPDEL TTKTSDPEKI SVSGDTFPST VKCNGFNQVP    900
LPISNNTTSE ENGDESNQTT NSSKPS*                                        960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_412.0e-19486635153+
COG0457NrfG3.0e-23100377283+
pfam13844Glyco_transf_413.0e-24658844187+
COG3914Spy7.0e-91316847561+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAX46402.1019131915putative SPINDLY protein [Rosa luciae]
RefSeqXP_002281883.1019131912PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308458.1019261934predicted protein [Populus trichocarpa]
RefSeqXP_002323412.1019071913predicted protein [Populus trichocarpa]
RefSeqXP_002530535.1019261930o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D4e-372216366386A Chain A, Bacillus Subtilis Pectate Lyase
PDB4gz6_D5e-22658853524715A Chain A, Bacillus Subtilis Pectate Lyase
PDB4gz6_D1e-171122686155A Chain A, Bacillus Subtilis Pectate Lyase
PDB4gz6_D0.00000000000000915930612152A Chain A, Bacillus Subtilis Pectate Lyase
PDB4gz6_D0.00000014919710152A Chain A, Bacillus Subtilis Pectate Lyase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2954084014298250
HO7812093574958510
HO7812091183925080
HO781209692112770.0002
HO781209583293845
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)