y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.007G368700.2
FamilyGH31
Protein PropertiesLength: 861 Molecular Weight: 96073.4 Isoelectric Point: 6.8773
ChromosomeChromosome/Scaffold: 07 Start: 60130611 End: 60135599
Descriptionalpha-xylosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH312737640
  FYFFSGPTPLDVVDQYTSFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYRKAQIPLDVIWNDDDHMDGHKDFTLNPVNYPRSKLLAFLDKIHNRGM
  KYIVIIDPGIGVNSSYGVYQRGIANDVFIKYDGEPYLAQVWPGAVNFPDFLNPKTVAWWGDEIRRFHELVPVDGLWIDMNEASNFCSGKCTIPKGKQCPS
  GTGPGWICCLDCKNITKTRWDDPPYKINASGLQVPIGFKTIATSAVHYNGVLEYDAHSLYGFSQAIATHKALQGLEGKRPFILSRSTYVGSGKYAAHWTG
  DNKGTWEDLKYSITTVLNFGIFGVPMVGADICGFYPAPTEELCNRWIEVGAFYPFSRDHANYYSPRQELYQWKTVTKSAQNALGMRYKLLPYLYTLNYLA
  HKSGAPIARPLFFSFPAYKECYGLSTQFLLGSSLMVSPVLEQGKTSVKALFPPGSWYNLFDMTQTIVSKGQYFMLDAPLHVVNVHLYQNTIL
Full Sequence
Protein Sequence     Length: 861     Download
MFSPASLLSL SSLYVLLVLL SCFFGGVSSV PTKVGKGYRL ISAEETSDGG FLGHLQVKQK    60
NNIYGPDIPL LQLYVKHDTG DRLRVHITDA EKQRWEVPYN LLPREQPPAL KQTIGRSRKN    120
LLTVSELAGS ELIFSFTADP FSFAVKRKSN GQTLFNSSSG GSDSFGEMVF KDQYLEISTQ    180
LPKDASLYGL GENTQPHGIK LYPNDPYTLY TTDVSAINLN TDLYGSHPVY MDLRNVGGEP    240
FAHAVLLLNS NGMDVFYKGN SLTYKIIGGV FDFYFFSGPT PLDVVDQYTS FIGRPAPMPY    300
WSLGFHQCRW GYHNLSVVED VVENYRKAQI PLDVIWNDDD HMDGHKDFTL NPVNYPRSKL    360
LAFLDKIHNR GMKYIVIIDP GIGVNSSYGV YQRGIANDVF IKYDGEPYLA QVWPGAVNFP    420
DFLNPKTVAW WGDEIRRFHE LVPVDGLWID MNEASNFCSG KCTIPKGKQC PSGTGPGWIC    480
CLDCKNITKT RWDDPPYKIN ASGLQVPIGF KTIATSAVHY NGVLEYDAHS LYGFSQAIAT    540
HKALQGLEGK RPFILSRSTY VGSGKYAAHW TGDNKGTWED LKYSITTVLN FGIFGVPMVG    600
ADICGFYPAP TEELCNRWIE VGAFYPFSRD HANYYSPRQE LYQWKTVTKS AQNALGMRYK    660
LLPYLYTLNY LAHKSGAPIA RPLFFSFPAY KECYGLSTQF LLGSSLMVSP VLEQGKTSVK    720
ALFPPGSWYN LFDMTQTIVS KGQYFMLDAP LHVVNVHLYQ NTILPMQQGG MISKEARMTP    780
FTLIVTFPAG ASEAQAKGNL YLDDDELPEM KLGNGYSTYV DLYATLKQGS VKIWSEVQEG    840
QILGLGSKSI GLNDQSDEHK *                                              900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01055Glyco_hydro_314.0e-89274461188+
cd06602GH31_MGAM_SI_GAA6.0e-92293457169+
cd06603GH31_GANC_GANAB_alpha2.0e-98293676390+
pfam01055Glyco_hydro_319.0e-107518764252+
cd06604GH31_glucosidase_II_MalA3.0e-122293676390+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN70430.10108411825hypothetical protein [Vitis vinifera]
RefSeqXP_002282429.10108411836PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002311455.10288419823predicted protein [Populus trichocarpa]
RefSeqXP_002315944.1068413841predicted protein [Populus trichocarpa]
RefSeqXP_002531635.10108418843alpha-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3w38_A01183712830A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB3w37_A01183712830A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB3lpp_D063858105856A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB3lpp_C063858105856A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB3lpp_B063858105856A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7953075872568410
HO777477523325540
ES8187153854338160
ES8191673035418430
HO777477445425850.55
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00336.5Aquca_014_00336.4Aquca_014_00336.3Aquca_014_00336.2Aquca_014_00336.1
Aquca_014_00336.6Aquca_026_00375.1Aquca_026_00374.1Aquca_026_00373.1Aquca_005_00561.8
Aquca_005_00561.7Aquca_005_00561.5Aquca_005_00561.4Aquca_005_00561.3Aquca_005_00561.2
Aquca_005_00561.1Aquca_005_00561.6Aquca_002_01146.1
Arabidopsis lyrata919683898886909139484972894626
865511862774
Arabidopsis thalianaAT5G63840.1AT3G23640.2AT3G23640.1AT5G11720.1AT3G45940.1
AT1G68560.1
Brachypodium distachyonBradi1g69780.1Bradi1g52510.1Bradi2g19280.1Bradi2g02070.1Bradi1g32650.1
Bradi2g10060.1
Brassica rapaBra024240Bra037754Bra028332Bra035407Bra004319
Bra006111Bra004031Bra028330
Carica papayaevm.model.supercontig_37.16evm.model.supercontig_1.180evm.model.supercontig_71.57evm.model.supercontig_5.162
Capsella rubellaCarubv10025824mCarubv10012876mCarubv10015582mCarubv10002711mCarubv10019747m
Chlamydomonas reinhardtiiCre03.g190500.t1.2Cre03.g194700.t1.3
Citrus clementinaCiclev10000200mCiclev10014196mCiclev10000152mCiclev10017610mCiclev10033422m
Ciclev10014274mCiclev10011016mCiclev10030449m.416.628Ciclev10030449m.416.628Ciclev10013535m
Ciclev10030449m.283.414Ciclev10030449m.283.414Ciclev10000404m.185.329Ciclev10000404m.185.329Ciclev10004303m
Citrus sinensisorange1.1g003671morange1.1g002442morange1.1g002568morange1.1g038998morange1.1g002256m
orange1.1g020492morange1.1g021825morange1.1g022976morange1.1g021612morange1.1g046216m
orange1.1g014924morange1.1g025445morange1.1g016744morange1.1g016738morange1.1g044305m
orange1.1g048354morange1.1g020723morange1.1g040705m
Cucumis sativusCucsa.228080.1Cucsa.322440.1Cucsa.236670.1Cucsa.365330.1Cucsa.283630.1
Cucsa.068450.1
Eucalyptus grandisEucgr.I00112.6Eucgr.I00112.5Eucgr.I00112.4Eucgr.I00112.3Eucgr.I00112.2
Eucgr.I00112.1Eucgr.E01212.2Eucgr.E01212.1Eucgr.K01952.1Eucgr.E01209.1
Eucgr.K01962.1Eucgr.K01954.1Eucgr.K01958.1Eucgr.L01888.1Eucgr.K01960.1
Eucgr.K01964.1Eucgr.L02199.1Eucgr.K01949.1Eucgr.G02327.1Eucgr.K01956.1
Eucgr.K01957.1Eucgr.K01953.1Eucgr.K01950.1Eucgr.L00881.1.54.343Eucgr.L00881.1.54.343
Eucgr.K01961.1Eucgr.L01889.1.188.355Eucgr.L01889.1.188.355Eucgr.L00881.1.347.493Eucgr.L00881.1.347.493
Eucgr.K01959.1Eucgr.A02235.1Eucgr.G00330.1
Fragaria vescamrna24190.1-v1.0-hybridmrna20103.1-v1.0-hybrid.273.739mrna20103.1-v1.0-hybrid.273.739mrna03754.1-v1.0-hybridmrna24638.1-v1.0-hybrid
mrna21878.1-v1.0-hybrid
Glycine maxGlyma04g38630.1Glyma06g16371.1Glyma09g03250.1Glyma15g14150.1Glyma04g14810.1
Glyma15g14140.2Glyma09g34850.1Glyma01g20460.1Glyma08g31890.1Glyma10g42140.1
Glyma15g14160.2Glyma03g28281.1
Gossypium raimondiiGorai.007G066900.6Gorai.007G066900.3Gorai.007G066900.2Gorai.007G066900.1Gorai.007G066900.4
Gorai.007G066900.5Gorai.009G115500.3Gorai.009G115500.1Gorai.005G124100.2Gorai.005G124100.1
Gorai.013G076300.2Gorai.013G076300.1Gorai.009G115500.2Gorai.007G368700.1Gorai.008G183500.2
Gorai.008G183500.1Gorai.009G115500.4Gorai.013G001500.1Gorai.013G001500.2Gorai.013G001500.3
Linum usitatissimumLus10033490Lus10020887Lus10038408Lus10008067Lus10034315
Lus10041457Lus10035020Lus10035019Lus10035671Lus10000779
Lus10000778Lus10021679Lus10031003
Malus domesticaMDP0000144090MDP0000178546MDP0000139428MDP0000894015MDP0000455477
MDP0000192721MDP0000208161MDP0000296747MDP0000169457MDP0000519142
MDP0000127634MDP0000776779MDP0000662421MDP0000238176
Manihot esculentacassava4.1_001195mcassava4.1_001191mcassava4.1_022477mcassava4.1_027331mcassava4.1_002192m
cassava4.1_001205mcassava4.1_001244mcassava4.1_001233mcassava4.1_002780mcassava4.1_006053m
cassava4.1_004250mcassava4.1_008696mcassava4.1_007575m
Medicago truncatulaMedtr3g096870.1AC235665_67.1Medtr5g026610.1Medtr5g057990.1Medtr2g031110.1.69.543
Medtr2g031110.1.69.543Medtr2g031110.1.69.543AC233660_42.1AC233660_28.1Medtr7g089780.1
Mimulus guttatusmgv1a001552mmgv1a001027mmgv1a001815mmgv1a001054mmgv1a000795m
mgv1a000741mmgv1a000940mmgv1a003100mmgv1a001294m
Oryza sativaLOC_Os03g11720.1LOC_Os06g46340.1LOC_Os06g46284.2LOC_Os06g46284.1LOC_Os07g23880.1
LOC_Os01g03950.1LOC_Os07g23944.1LOC_Os01g16310.1
Panicum virgatumPavirv00007084mPavirv00007083mPavirv00059282mPavirv00000653mPavirv00014847m
Pavirv00031858mPavirv00011190mPavirv00049442mPavirv00025581mPavirv00065694m
Pavirv00021444m
Physcomitrella patensPp1s109_267V6.2Pp1s109_267V6.1Pp1s5_330V6.1Pp1s242_48V6.1Pp1s140_141V6.1
Pp1s41_235V6.1Pp1s60_162V6.1Pp1s157_63V6.1Pp1s25_97V6.1Pp1s11_406V6.1
Pp1s80_200V6.1Pp1s86_178V6.1Pp1s13_451V6.1Pp1s264_36V6.1Pp1s264_60V6.1
Pp1s119_138V6.1Pp1s6_50V6.1Pp1s43_19V6.1Pp1s245_102V6.1Pp1s281_10V6.1
Pp1s41_238V6.1Pp1s65_69V6.1
Phaseolus vulgarisPhvul.009G153400.1Phvul.002G127000.1Phvul.006G125100.1Phvul.002G126900.1Phvul.003G035400.1
Phvul.007G026900.1Phvul.001G123000.1
Picea abiesMA_10430549g0010MA_102800g0010MA_110168g0010MA_9807255g0010MA_10426288g0010
MA_10431114g0020MA_10436707g0010MA_10431114g0010MA_10435316g0010MA_5372344g0010
Populus trichocarpaPotri.007G100000.1Potri.005G069000.1Potri.001G129600.4Potri.001G129600.2Potri.011G154200.1
Potri.011G154300.1Potri.001G129600.1Potri.011G154500.2Potri.011G154500.1Potri.001G442800.1
Potri.001G129600.3Potri.010G125800.1Potri.008G120000.2Potri.008G120000.1Potri.001G442800.2
Potri.006G039500.1Potri.001G442700.1
Prunus persicappa001032mppa001168mppa001103mppa001098mppa000927m
ppa001232m
Ricinus communis29687.m00059729827.m00260228458.m00004829776.m00046827524.m000301
29733.m00074634899.m00001952272.m000013
Setaria italicaSi034132mSi005827mSi028815mSi000221mSi000237m
Selaginella moellendorffii142083923397985582321
Sorghum bicolorSb01g042750.1Sb10g027110.1Sb03g007230.1Sb02g010060.1.193.392Sb02g010060.1.193.392
Sb02g010060.1.393.531Sb02g010060.1.393.531Sb03g010640.1.716.836Sb03g010640.1.716.836Sb03g010640.1.427.700
Sb03g010640.1.427.700
Thellungiella halophilaThhalv10003620mThhalv10019990mThhalv10019989mThhalv10012616mThhalv10012743m
Thhalv10018167mThhalv10018090m
Vitis viniferaGSVIVT01020935001GSVIVT01024287001GSVIVT01022815001GSVIVT01037959001.254.722GSVIVT01037959001.254.722
GSVIVT01011904001GSVIVT01036946001GSVIVT01033641001
Volvox carteriVocar20005557m
Zea maysAC203753.4_FGT006
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)