y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G014000.1
FamilyGT13
Protein PropertiesLength: 446 Molecular Weight: 52011.4 Isoelectric Point: 6.2616
ChromosomeChromosome/Scaffold: 08 Start: 1621451 End: 1627037
Descriptionalpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT13224380
  IQMRLFTTQSEYADRMAEAVDAEHHCTSQMRLLIDQISMQQEQIVALEEGKKRKDQECAQLKTLVNDLEKKALQRVIDKTQVPVAAVVIMACNRADYLER
  TVASVLKYQSSVASKYPLFVSQDGSDPRVKTKALSYKELTYMQHIDYDPVHTDRPGELIAYYKIARHYKWALDELFYKHNFDRVIILEDDMEIAPDFFDY
  FEAAAALLDKDKSIMAVSSWNDNGQKQFVYDPYALYRSDFFPGLGWMLTRSVWNELSPKWPKFTYWDDWLRLKQNHKGRQFLRPEVCRTYNFGEHGSSMG
  QFFEKYLAPIKMNDVKVDWKSQDLSYLTEDKYAQYFADILKMAKPIPGTDPALMASNIEGDIRIQYRDQSDFEYIAQQFGVFEEWKDGVPRTAYKGVVVF
  RYHPPRRVFLVGPDSLQ
Full Sequence
Protein Sequence     Length: 446     Download
MAKLSCDFRY LLIPAAFVFI YIQMRLFTTQ SEYADRMAEA VDAEHHCTSQ MRLLIDQISM    60
QQEQIVALEE GKKRKDQECA QLKTLVNDLE KKALQRVIDK TQVPVAAVVI MACNRADYLE    120
RTVASVLKYQ SSVASKYPLF VSQDGSDPRV KTKALSYKEL TYMQHIDYDP VHTDRPGELI    180
AYYKIARHYK WALDELFYKH NFDRVIILED DMEIAPDFFD YFEAAAALLD KDKSIMAVSS    240
WNDNGQKQFV YDPYALYRSD FFPGLGWMLT RSVWNELSPK WPKFTYWDDW LRLKQNHKGR    300
QFLRPEVCRT YNFGEHGSSM GQFFEKYLAP IKMNDVKVDW KSQDLSYLTE DKYAQYFADI    360
LKMAKPIPGT DPALMASNIE GDIRIQYRDQ SDFEYIAQQF GVFEEWKDGV PRTAYKGVVV    420
FRYHPPRRVF LVGPDSLQQL GIENA*                                         480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13641Glyco_tranf_2_30.0002107311227+
cd00761Glyco_tranf_GTA_type2.0e-5108291184+
cd02514GT13_GLCNAC-TI1.0e-165105436337+
pfam03071GNT-I013444438+
Gene Ontology
GO TermDescription
GO:0000139Golgi membrane
GO:0003827alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAC80697.1034455446N-acetylglucosaminyltransferase I [Solanum tuberosum]
EMBLCAC80700.1014451444N-acetylglucosaminyltransferase I [Arabidopsis thaliana]
EMBLCAC80702.1034455446N-acetylglucosaminyltransferase I [Nicotiana tabacum]
EMBLCBI29533.1014431439unnamed protein product [Vitis vinifera]
RefSeqNP_195537.2014451444CGL1 (COMPLEX GLYCAN LESS 1); alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase/ protein N-acetylglucosaminyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1foa_A01024365339A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo9_A01024365339A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo8_A01054363334A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
PDB2apc_A01054362333A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
PDB2am5_A01054362333A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8416563211284450
GO802527324293510
EH7311532951524460
GO802714314293410
GO865783327103360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00911.3Aquca_007_00911.4Aquca_007_00911.2Aquca_007_00911.1Aquca_007_00911.5
Arabidopsis lyrata912565490588
Arabidopsis thalianaAT4G38240.1AT4G38240.2AT4G38240.3
Brachypodium distachyonBradi3g60820.3Bradi3g60820.1Bradi3g60820.2
Brassica rapaBra033557
Carica papayaevm.TU.contig_28580.1.22.235evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.22.235
Capsella rubellaCarubv10007540m
Citrus clementinaCiclev10028418m
Citrus sinensisorange1.1g019888morange1.1g012912morange1.1g012941m
Cucumis sativusCucsa.099720.1Cucsa.099720.2
Eucalyptus grandisEucgr.L00584.1Eucgr.L00583.1Eucgr.H04987.1Eucgr.H04987.2Eucgr.H04989.3
Eucgr.H04989.2Eucgr.H04989.4Eucgr.H04989.1
Fragaria vescamrna17328.1-v1.0-hybrid
Glycine maxGlyma04g00200.1Glyma06g00230.1
Gossypium raimondiiGorai.008G014000.2Gorai.008G014000.3
Linum usitatissimumLus10022994Lus10001389
Malus domesticaMDP0000173465.283.435MDP0000170967.230.351MDP0000170967.22.209MDP0000170967.22.209MDP0000173465.283.435
MDP0000173465.22.268MDP0000173465.22.268MDP0000170967.230.351
Manihot esculentacassava4.1_024783m
Medicago truncatulaMedtr3g118520.1Medtr3g118520.2Medtr3g118520.3
Mimulus guttatusmgv1a006517mmgv1a006750m
Oryza sativaLOC_Os02g58590.1.304.426LOC_Os02g58590.1.304.426LOC_Os02g58590.1.22.283LOC_Os02g58590.1.22.283
Panicum virgatumPavirv00053907mPavirv00020030m
Physcomitrella patensPp1s100_54V6.1Pp1s246_61V6.1
Phaseolus vulgarisPhvul.009G115600.1
Picea abiesMA_901813g0010
Populus trichocarpaPotri.009G168000.2Potri.009G168000.1Potri.009G168000.4Potri.004G206900.3Potri.004G206900.1
Potri.004G206900.2Potri.009G168000.3
Prunus persicappa006221m
Ricinus communis29675.m000398.22.23129675.m000398.232.34829675.m000398.232.34829675.m000398.22.231
Setaria italicaSi006441mSi006440m
Selaginella moellendorffii268301
Sorghum bicolorSb08g003660.1
Thellungiella halophilaThhalv10025211mThhalv10025208mThhalv10025250m
Vitis viniferaGSVIVT01002028001GSVIVT01002907001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny