y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G022000.3
FamilyGH95
Protein PropertiesLength: 613 Molecular Weight: 68688.5 Isoelectric Point: 4.8557
ChromosomeChromosome/Scaffold: 08 Start: 2501223 End: 2505819
Description1,2-alpha-L-fucosidases
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH95266100
  TSRPLKVIFNEPAKYWTDALPVGNGRLGAMIWGGVASELIQLNEDTLWTGVPGDYTNPNAPYALSEIRKLVDSGEFAEATAAAAKLVGNPADVYQLLGDI
  KLEFDDSHLSYDKETYQRELDLDNATVQIKYTVDGVEFSREHFASNPDQVMVTKISGTKPGSVSFTVYLDSKLDHHCKTNGESQVILEGHCPEKRIPPQV
  YADDKPKGIQFSAVLDLKISKGNGIVHILDDSKLRVEGSDWAILFLVASSSFDGPFTKPSDSKKDPTSDSLNVLKSISNLSYVDLYAHHLDDYQNLFRRV
  SLQFSKSSRSVVCLKKNQDGRVPTTAERIKSFQMDEDPYLVELLFQFGRYLLISSSRPGTQVANLQGIWNKDLEPKWDSAPHLNINLEMNYWPSLPCNLS
  ECQEPLFDFLSSLSVNGRKTAEVNYETSGWVVHHKSDIWAKSSADAGDVDWALWPMGGAWLCVHLWEHYTYTMDIDFLKDKAYPLLKGCGIFLLDWLIEG
  KGGYLETNPSTSPEHDFIAPDGNRASVSYSSTMDMAIIKEVFSVIVSAAEVLDKNEDDLVKRVRKAQSRLYPTKVAKDGSIMEWV
Full Sequence
Protein Sequence     Length: 613     Download
MRDEEWIMVR RPTVADLWNP CFSDSTSRPL KVIFNEPAKY WTDALPVGNG RLGAMIWGGV    60
ASELIQLNED TLWTGVPGDY TNPNAPYALS EIRKLVDSGE FAEATAAAAK LVGNPADVYQ    120
LLGDIKLEFD DSHLSYDKET YQRELDLDNA TVQIKYTVDG VEFSREHFAS NPDQVMVTKI    180
SGTKPGSVSF TVYLDSKLDH HCKTNGESQV ILEGHCPEKR IPPQVYADDK PKGIQFSAVL    240
DLKISKGNGI VHILDDSKLR VEGSDWAILF LVASSSFDGP FTKPSDSKKD PTSDSLNVLK    300
SISNLSYVDL YAHHLDDYQN LFRRVSLQFS KSSRSVVCLK KNQDGRVPTT AERIKSFQMD    360
EDPYLVELLF QFGRYLLISS SRPGTQVANL QGIWNKDLEP KWDSAPHLNI NLEMNYWPSL    420
PCNLSECQEP LFDFLSSLSV NGRKTAEVNY ETSGWVVHHK SDIWAKSSAD AGDVDWALWP    480
MGGAWLCVHL WEHYTYTMDI DFLKDKAYPL LKGCGIFLLD WLIEGKGGYL ETNPSTSPEH    540
DFIAPDGNRA SVSYSSTMDM AIIKEVFSVI VSAAEVLDKN EDDLVKRVRK AQSRLYPTKV    600
AKDGSIMEWV CQ*                                                       660
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002270199.1016101630PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298754.10266108592predicted protein [Populus trichocarpa]
RefSeqXP_002313154.102761010587predicted protein [Populus trichocarpa]
RefSeqXP_002313157.1016101624predicted protein [Populus trichocarpa]
RefSeqXP_002527475.1016101621conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B0306093574A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A0306093574A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_B0460917653A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_A0460917653A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eab_B0460917653A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum (Apo Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY275135392344220
GT0196332723386090
ES8394922543576100
FC916535299343320
DT5584932893195900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)