y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G022200.2
FamilyGH95
Protein PropertiesLength: 673 Molecular Weight: 74383.8 Isoelectric Point: 5.3808
ChromosomeChromosome/Scaffold: 08 Start: 2509293 End: 2515171
Description1,2-alpha-L-fucosidases
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH95286710
  TSKPLKVTFSGPAKHWTDAIPIGNGRLGAMVWGGIASETLQLNEDTLWTGVPGDYTNPEAPAALAEVRKLVDNGDYAEATKAAVKLSDHPSDVYQLLGDI
  KLEFDESHVKYTEGTYSRELDLETATARVKYSVGDVEFTREHFASNPGQVLVTKISASKPGSLSFTVSLDSKLHHHSQANGQNQIILQGSCPGKRIQPKV
  GLNETPKGIQFTAVLDLQVSQGGVIHNIDDKKLKVEGSDWAVLLLVASSSFDGPFTMPSDSKKDPTSETLNALKSIKTLSYSDLYAHHLDDYQNLFHRVS
  LQLSKSSKSNLGDGSLEMKEVKSSTKNSHFSESNDGAVSTAERVKSFQTDEDPSFVELLFQYGRYLLISSSRPGTQVSNLQGIWNKDIEPAWDCAPHLNI
  NLQMNYWPSLPCNLKECQEPLFDFISSLAINGSKTAKVNYETSGWVAHQVTDIWAKTSPDRGEAVWALWPMGGAWLCTHLWEHFTYTMDKDFLKNKAYPL
  LEGCTSFLLDWLIEGPGGYLETNPSTSPEHMFVAPDGKPASVSYSSTMDIAIIREVFSEIVSAAEVLGRKDDALIGKVREAQAKLPPTKIARDGSIMEWA
  VDFQDPEVHHRHVSHLFGLFPGHMITVEKTPDLCKAVDFTLFKR
Full Sequence
Protein Sequence     Length: 673     Download
MEDGEWVLVR KPAEKDFWNP TSMDLADTSK PLKVTFSGPA KHWTDAIPIG NGRLGAMVWG    60
GIASETLQLN EDTLWTGVPG DYTNPEAPAA LAEVRKLVDN GDYAEATKAA VKLSDHPSDV    120
YQLLGDIKLE FDESHVKYTE GTYSRELDLE TATARVKYSV GDVEFTREHF ASNPGQVLVT    180
KISASKPGSL SFTVSLDSKL HHHSQANGQN QIILQGSCPG KRIQPKVGLN ETPKGIQFTA    240
VLDLQVSQGG VIHNIDDKKL KVEGSDWAVL LLVASSSFDG PFTMPSDSKK DPTSETLNAL    300
KSIKTLSYSD LYAHHLDDYQ NLFHRVSLQL SKSSKSNLGD GSLEMKEVKS STKNSHFSES    360
NDGAVSTAER VKSFQTDEDP SFVELLFQYG RYLLISSSRP GTQVSNLQGI WNKDIEPAWD    420
CAPHLNINLQ MNYWPSLPCN LKECQEPLFD FISSLAINGS KTAKVNYETS GWVAHQVTDI    480
WAKTSPDRGE AVWALWPMGG AWLCTHLWEH FTYTMDKDFL KNKAYPLLEG CTSFLLDWLI    540
EGPGGYLETN PSTSPEHMFV APDGKPASVS YSSTMDIAII REVFSEIVSA AEVLGRKDDA    600
LIGKVREAQA KLPPTKIARD GSIMEWAVDF QDPEVHHRHV SHLFGLFPGH MITVEKTPDL    660
CKAVDFTLFK RV*                                                       720
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002270199.1016711674PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298754.10266716636predicted protein [Populus trichocarpa]
RefSeqXP_002313154.10246715631predicted protein [Populus trichocarpa]
RefSeqXP_002313157.1016711668predicted protein [Populus trichocarpa]
RefSeqXP_002527476.1026714677conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B0326713619A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A0326713619A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_B04765752697A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_A04765752697A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eab_B04765752697A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum (Apo Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8394922953746670
DT5584932853206040
DT55594526012600
EX2638602644086710
DV1359912664036680
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022000.2Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)