y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G036000.1
FamilyGH35
Protein PropertiesLength: 845 Molecular Weight: 95309.2 Isoelectric Point: 8.4363
ChromosomeChromosome/Scaffold: 08 Start: 4448353 End: 4453031
Descriptionglycosyl hydrolase family 35 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35533570
  LLVNGKRMLFFSGSIHYPRSPPDAWPDLIRKAKMGGLNMVETYVFWNVHEPVQGKYNFEGEYDLVKFIKLIQQNKMFAMLRVGPFVQGEWNHGGLPYWLR
  EVPNIIFRCDNEPFKMHMKKFVTLVIEKMKQAKLFAPQGGPIIVSQIENEYNTIQLAFRERGDSYVQWAAKMALSLDTKVPWIMCKQKDAPDPIINTCNG
  RHCGDTFTGPNGPNKPFLWTENWTAQFRVFGDPPSQRSAEDLAFSIIRFCSKNGTLVNYYMYHGGTNFGRTSSSFTTTRYYDEAPLDEFGLIREPKWGHL
  KDAHR
Full Sequence
Protein Sequence     Length: 845     Download
MVQVEPGRIL LITFLSTLLI TSSIAQKEDE EEVDPDSPES TTPKEVTYDS RSLLVNGKRM    60
LFFSGSIHYP RSPPDAWPDL IRKAKMGGLN MVETYVFWNV HEPVQGKYNF EGEYDLVKFI    120
KLIQQNKMFA MLRVGPFVQG EWNHGGLPYW LREVPNIIFR CDNEPFKMHM KKFVTLVIEK    180
MKQAKLFAPQ GGPIIVSQIE NEYNTIQLAF RERGDSYVQW AAKMALSLDT KVPWIMCKQK    240
DAPDPIINTC NGRHCGDTFT GPNGPNKPFL WTENWTAQFR VFGDPPSQRS AEDLAFSIIR    300
FCSKNGTLVN YYMYHGGTNF GRTSSSFTTT RYYDEAPLDE FGLIREPKWG HLKDAHRAVN    360
LCKRALFSGS PFVQKLGPDQ EARVWEQPGT SLCSAFLTNN NTKKPQALRF RGQDYQLPPR    420
SISILPDCKT EVFNSQMITT HHNSRNIVRS IAANKNFNWE MYREVVPDDP GNKLNEPREL    480
YELTKDTSDY AWYITKLDLG RRDLPMKNEI LPVLRVASLG HGLHCYVNGK YIGSAHGSKV    540
EKSFVFQKPV EFQAGSNQIA LLGFLVGLPD SGAYMEKRYA GPRSITILGL NTGTLDITLN    600
TWSHQVGLDG EKNQIYTQNG FPKVQWVKGG PSEGVTWYKG YFDAPEGDNP VAVKMTGMGK    660
GMVYINGRNI GRYWMSYLSP LKRPTQSEYH IPRSYLQPTM NLIVIVEDEK GDPKNIEIVL    720
VDRDTICGFI TENHLPSVRL FEGKGGKLVA LEKDLKPRVE LACPGQKQIV AVEFASFGDP    780
FGACGHYVEG NCTSPVAKQV VEKFCLGKPS CKIPLDTPDL HNKNEACPEM KKTLAIQAKC    840
AFKA*                                                                900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_423.0e-673212167+
pfam02140Gal_Lectin4.0e-1376184083+
COG1874LacA9.0e-1746203168+
pfam01301Glyco_hydro_351.0e-13252359322+
PLN03059PLN03059046841826+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAS76480.1048412843beta-galactosidase [Gossypium hirsutum]
GenBankACC60982.104684328829beta-galactosidase 2 precursor [Petunia x hybrida]
RefSeqXP_002278545.104484430833PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306183.104484429830predicted protein [Populus trichocarpa]
RefSeqXP_002312963.104684331828predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D2e-394534610322A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB3thd_D0.0003636734527629A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB3thd_C2e-394534610322A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB3thd_C0.0003636734527629A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB3thd_B2e-394534610322A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160701457180
CO1145162705187870
HO780602592966790
CO128575295753690
CO1211552901013900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)