y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G046700.3
FamilyGH116
Protein PropertiesLength: 773 Molecular Weight: 86216.1 Isoelectric Point: 5.6905
ChromosomeChromosome/Scaffold: 08 Start: 6316666 End: 6323891
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165317670
  GQFLYLEGIEYHMWNTYDVHFYASFALIMLFPKLQLSIQRDFAAAVMMHDPSKMKLLHDGQLVARKVLGAVPHDIGMDDPWFEVNAYCLYDTDRWKDLNP
  KFVLQVYRDVIATGDKKFAQTVWPSVYVAMAYMDQFDKDGDGMIENDGFPDQTYDTWSVSGVSAYSGGLWVAALQAASALAHEVGDKGSEDYFWYKFLKA
  KDVYQKLWNGSYFNYDNSGSRTSSSIQADQLAGQWSV
Full Sequence
Protein Sequence     Length: 773     Download
MSERKILENG FDEGDKDTSN HSINKVDTGK PPSLTWRRKL NGEGRVPSMF TLTFQEKLQM    60
APIGIRLWQL IRESSAKGRR GIIIDPFAKR HITSSHGIPL GGVGAGSIGR SYKGEFQRWQ    120
LFPRICEEKP VLANQFSVFV SRSSGEKYSS VLCPASSELL KEDAVSGIGS WDWNLRGNNS    180
TYHALYPRAW TVYEGEPDPE LKIVCRQISP VIPDNYKESS FPVSAFTFTL YNTGNINADV    240
TLLFTWANSV GGVSEFSGRH SNSKLIMKDG VHGVLLHHMT ADEQPPVTFA IAAQETDGIR    300
ISECPCFLIS GNSQGITAKE MWQEIKEHGS FEHLKSTEAS VPSEQGSSIG AAIAASVTIP    360
SDAVRTVNFS LAWDCPEVNF MGGKTYYRRY TKFYGSNGDA AANIAHDAIL EHNSWESQIE    420
TWQRPVLEDK RLPEWYPFTL FNELYYLNSG GTIWTDGSSP VHSLVSIGGK KFSLDKSQLG    480
LKSIIGVPHK NDTAIDILGR MTSILEQIHT PITSNSALGT NLLQEGEENI GQFLYLEGIE    540
YHMWNTYDVH FYASFALIML FPKLQLSIQR DFAAAVMMHD PSKMKLLHDG QLVARKVLGA    600
VPHDIGMDDP WFEVNAYCLY DTDRWKDLNP KFVLQVYRDV IATGDKKFAQ TVWPSVYVAM    660
AYMDQFDKDG DGMIENDGFP DQTYDTWSVS GVSAYSGGLW VAALQAASAL AHEVGDKGSE    720
DYFWYKFLKA KDVYQKLWNG SYFNYDNSGS RTSSSIQADQ LAGQWSVMMD VT*           780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43544.0e-3096456377+
COG4354COG43542.0e-43530765251+
pfam12215GBA2_N2.0e-6297415327+
pfam04685DUF6084.0e-99531765240+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAE99037.1017651762hypothetical protein [Arabidopsis thaliana]
RefSeqXP_002264575.1067651761PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328722.10257651733predicted protein [Populus trichocarpa]
RefSeqXP_002331126.1017651759predicted protein [Populus trichocarpa]
RefSeqXP_002528846.1017651763conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY6694432893576450
DW49158822912290
DW49158722912290
FC8953222984047010
GT1760603274397650
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)