y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G069000.1
FamilyAA6
Protein PropertiesLength: 258 Molecular Weight: 27200.8 Isoelectric Point: 5.5899
ChromosomeChromosome/Scaffold: 08 Start: 11405439 End: 11409172
DescriptionQuinone reductase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA6582520
  KVFIVFYSMYGHVEKLAKRMKKGVEGVEGVEAVLYRVPETLPDEVLEHMKAPPKAPEVPEIKAEELAVADAILFGFPTRYGCMAAQMKAFFDSTGQLWKE
  QTLVGKPAGFFVSTGAQGGGQETTAWTAITQLAHHGMLFVPIGYTFGDDMSKIDFIHGGSPYGAGVYAGDGTREPTEIELALAEHQGKYMAGVAK
Full Sequence
Protein Sequence     Length: 258     Download
MGKGGGCVPS KKKHPTSAED AAGTSSTTAP IAADEETHAT PTVTESSENA QSVAATVKVF    60
IVFYSMYGHV EKLAKRMKKG VEGVEGVEAV LYRVPETLPD EVLEHMKAPP KAPEVPEIKA    120
EELAVADAIL FGFPTRYGCM AAQMKAFFDS TGQLWKEQTL VGKPAGFFVS TGAQGGGQET    180
TAWTAITQLA HHGMLFVPIG YTFGDDMSKI DFIHGGSPYG AGVYAGDGTR EPTEIELALA    240
EHQGKYMAGV AKRLSQG*                                                  300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00258Flavodoxin_11.0e-861170121+
pfam03358FMN_red5.0e-1098201104+
COG0655WrbA9.0e-3157255206+
TIGR01755flav_wrbA6.0e-5357254199+
PRK03767PRK037678.0e-6257254201+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0010181FMN binding
GO:0016491oxidoreductase activity
GO:0050662coenzyme binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM64959.1012561272minor allergen [Arabidopsis thaliana]
RefSeqNP_195393.1012561272quinone reductase family protein [Arabidopsis thaliana]
RefSeqXP_002273030.1012561255PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310794.1012561253predicted protein [Populus trichocarpa]
RefSeqXP_002525103.1012561256Minor allergen Alt a, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4dy4_C0582552196A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB4dy4_A0582552196A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB3b6m_B0582553197A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB3b6m_A0582553197A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB3b6k_B0582553197A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW22812526212560
DT57238926212580
DT56366725392540
JK79223724822450
DT57266724612420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00427.1Aquca_028_00272.1Aquca_028_00272.2Aquca_045_00040.1Aquca_028_00272.4
Aquca_028_00272.3Aquca_045_00041.1
Arabidopsis lyrata912689492071495531497377496008
Arabidopsis thalianaAT4G36750.1AT4G27270.1AT5G54500.1AT5G58800.2AT5G58800.1
AT5G54500.2
Brachypodium distachyonBradi3g27210.2Bradi2g51980.1Bradi2g20710.2Bradi1g59450.1Bradi1g59440.1
Bradi1g08640.1Bradi2g20710.1
Brassica rapaBra017781Bra029025Bra022724Bra002982Bra020352
Bra026364Bra020939Bra024671Bra033447Bra026424
Bra015354Bra026588Bra028316Bra013991
Carica papayaevm.model.supercontig_62.114evm.model.supercontig_12.2evm.model.supercontig_27.163evm.model.supercontig_112.39
Capsella rubellaCarubv10007228mCarubv10027151mCarubv10027183mCarubv10005724mCarubv10027138m
Chlamydomonas reinhardtiiCre10.g456000.t1.2Cre10.g456050.t2.1Cre10.g456050.t1.2Cre10.g456100.t1.2g11188.t1
Citrus clementinaCiclev10026310mCiclev10029120mCiclev10009497mCiclev10009518mCiclev10016752m
Ciclev10029300mCiclev10009723mCiclev10017062mCiclev10029304m
Citrus sinensisorange1.1g024934morange1.1g040588morange1.1g029532morange1.1g028841morange1.1g029479m
orange1.1g028847morange1.1g028917morange1.1g031039morange1.1g031827morange1.1g031823m
orange1.1g031807morange1.1g031886m
Cucumis sativusCucsa.104940.1Cucsa.109910.1Cucsa.059590.1Cucsa.045690.1Cucsa.045690.2
Cucsa.139160.1
Eucalyptus grandisEucgr.I01248.1Eucgr.D00882.1Eucgr.F03383.1Eucgr.B02266.3Eucgr.B02266.2
Eucgr.B02266.1Eucgr.B02266.4Eucgr.I01248.2Eucgr.I02466.1
Fragaria vescamrna29536.1-v1.0-hybridmrna02174.1-v1.0-hybridmrna03258.1-v1.0-hybridmrna30664.1-v1.0-hybridmrna07872.1-v1.0-hybrid
Glycine maxGlyma11g06920.1Glyma01g38400.1Glyma11g12790.1Glyma12g04940.1Glyma12g17680.1
Glyma12g34500.2Glyma12g34500.1Glyma12g17680.2Glyma13g35994.1Glyma12g25950.1
Glyma07g30750.1Glyma08g06570.1Glyma15g07040.2Glyma15g07040.1Glyma13g32300.1
Glyma13g32300.2Glyma14g37150.3Glyma14g37150.2Glyma14g37150.1Glyma13g32310.1
Glyma06g40750.2Glyma06g40700.1Glyma12g25950.2Glyma06g40730.1Glyma08g06570.2
Glyma06g39970.1Glyma19g02750.2Glyma04g13531.1Glyma06g40810.2Glyma12g23000.2
Glyma14g22010.1Glyma11g33050.2
Gossypium raimondiiGorai.003G016700.1Gorai.005G228800.3Gorai.005G228800.2Gorai.005G228800.1Gorai.007G206100.3
Gorai.007G206100.1Gorai.009G429200.1Gorai.002G079100.1Gorai.011G020200.1Gorai.003G123300.6
Gorai.003G123300.5Gorai.003G123300.4Gorai.003G123300.2Gorai.003G123300.1Gorai.003G123300.7
Gorai.003G123300.8Gorai.009G429200.2Gorai.002G079100.2Gorai.003G123300.9Gorai.007G206100.2
Gorai.003G123300.3
Linum usitatissimumLus10014325Lus10026035Lus10041718Lus10040486Lus10018401
Lus10007612Lus10006748Lus10020076Lus10005862Lus10024032
Malus domesticaMDP0000404722MDP0000301453MDP0000896493MDP0000393227MDP0000509613
MDP0000829416MDP0000295439MDP0000181421.64.175MDP0000181421.64.175MDP0000181421.214.283
MDP0000181421.214.283MDP0000667053
Manihot esculentacassava4.1_013993mcassava4.1_015848mcassava4.1_016492mcassava4.1_016498mcassava4.1_016478m
cassava4.1_030159mcassava4.1_016500m
Medicago truncatulaMedtr5g019620.1Medtr2g081810.1Medtr5g070030.1Medtr2g011080.1Medtr2g011080.2
Mimulus guttatusmgv1a011919mmgv1a026744mmgv1a014007mmgv1a013996mmgv1a014020m
mgv1a013995m
Oryza sativaLOC_Os01g57570.1LOC_Os05g42190.1LOC_Os08g04460.1LOC_Os03g53730.1LOC_Os01g57570.2
LOC_Os08g04460.2
Panicum virgatumPavirv00064613mPavirv00046437mPavirv00014837mPavirv00023949mPavirv00031126m
Pavirv00039933mPavirv00036713mPavirv00019037m
Physcomitrella patensPp1s475_5V6.5Pp1s475_5V6.4Pp1s475_5V6.3Pp1s475_5V6.2Pp1s475_5V6.1
Pp1s32_160V6.1Pp1s55_98V6.1Pp1s352_29V6.1Pp1s227_23V6.1Pp1s114_114V6.1
Pp1s270_78V6.1
Phaseolus vulgarisPhvul.002G027100.1Phvul.011G047200.1Phvul.011G152500.1Phvul.005G088900.1Phvul.005G088900.2
Phvul.006G194800.1Phvul.002G219700.1Phvul.006G194900.1Phvul.008G262200.1Phvul.011G152900.1
Phvul.005G088900.3Phvul.011G152800.1Phvul.011G153100.1
Picea abiesMA_125690g0020MA_10426786g0010MA_10434600g0010MA_206492g0010MA_159008g0220
MA_28841g0010MA_479276g0010
Populus trichocarpaPotri.007G029600.1Potri.005G126200.1Potri.004G151100.1Potri.001G410700.1Potri.011G129400.2
Potri.011G129400.1Potri.004G028900.1Potri.011G033100.1Potri.009G044400.7Potri.009G044400.6
Potri.009G044400.5Potri.009G044400.1Potri.009G044400.4Potri.009G044400.2Potri.011G033100.2
Potri.009G044400.3
Prunus persicappa011578mppa010049mppa011617mppa011600mppa011625m
ppa011865m
Ricinus communis29646.m00106529851.m00244127733.m00003229842.m00370529681.m001326
Setaria italicaSi037123mSi023271mSi015648mSi002660mSi031096m
Selaginella moellendorffii229897232063
Sorghum bicolorSb01g021290.2Sb01g021290.1Sb03g036660.1Sb02g000630.1Sb09g024730.2
Sb09g024730.1Sb02g006210.1Sb03g036660.2Sb04g023400.1
Thellungiella halophilaThhalv10025964mThhalv10014706mThhalv10026307mThhalv10014693mThhalv10014690m
Thhalv10014688m
Vitis viniferaGSVIVT01031920001GSVIVT01014540001GSVIVT01005305001GSVIVT01019014001GSVIVT01005278001
GSVIVT01005303001GSVIVT01024768001
Volvox carteriVocar20014747mVocar20014778m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)