y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G075700.1
FamilyGH35
Protein PropertiesLength: 209 Molecular Weight: 23885.1 Isoelectric Point: 10.249
ChromosomeChromosome/Scaffold: 08 Start: 13925743 End: 13929337
Descriptionbeta-galactosidase 17
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35881765.4e-39
  FWKDGKPFQIIFGDLHYFRVLLEYWEDRLLRAKALGLNTIQTSIPWNLHEPEAGKLVFEGIADLVSFLKLCQKLGLLAMLRAGPYICAD
Full Sequence
Protein Sequence     Length: 209     Download
MNRSKSLAVT SKSITAMARK RSSKTMLISF LLLSLLAFLY FLPVFASLPS LPSYSHSHDL    60
HFHLPRHQRL HRRQKIGVRK FEIAEDKFWK DGKPFQIIFG DLHYFRVLLE YWEDRLLRAK    120
ALGLNTIQTS IPWNLHEPEA GKLVFEGIAD LVSFLKLCQK LGLLAMLRAG PYICADPRDS    180
ETVRPLDLHH SMEVHLSLSK GSVCPSFM*                                      240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3250LacZ0.000374194127+
COG1874LacA3.0e-188617187+
PLN03059PLN030591.0e-199717680+
pfam01301Glyco_hydro_356.0e-488817588+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD28500.207917652149Glycoside hydrolase, family 35 [Medicago truncatula]
EMBLCBI35958.1031768170unnamed protein product [Vitis vinifera]
RefSeqNP_565051.107419856187BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002280228.107917649146PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002527397.107917853152beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D6e-28791767106A Chain A, Peanut Peroxidase
PDB3thd_C6e-28791767106A Chain A, Peanut Peroxidase
PDB3thd_B6e-28791767106A Chain A, Peanut Peroxidase
PDB3thd_A6e-28791767106A Chain A, Peanut Peroxidase
PDB3thc_D6e-28791767106A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Transmembrane Domains
StartEnd
2648
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES84152317611760
BQ40361817611760
ES82378217611760
JG85878117511740
BQ40846017111710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00429.1
Arabidopsis lyrata877397
Arabidopsis thalianaAT1G72990.2AT1G72990.1
Brachypodium distachyonBradi2g18440.2Bradi2g18440.3
Brassica rapaBra003861
Carica papayaevm.model.supercontig_1398.1evm.model.supercontig_25.44
Capsella rubellaCarubv10022320m
Citrus clementinaCiclev10024990mCiclev10024996m
Citrus sinensisorange1.1g011205morange1.1g006708morange1.1g006713morange1.1g006715morange1.1g006845m
orange1.1g007259morange1.1g009269morange1.1g011211m
Cucumis sativusCucsa.341150.1
Eucalyptus grandisEucgr.J02679.1Eucgr.J02852.1
Fragaria vescamrna23038.1-v1.0-hybrid
Glycine maxGlyma13g42560.1Glyma13g42560.2
Gossypium raimondiiGorai.008G075700.2Gorai.009G141300.1Gorai.009G141300.2Gorai.009G141300.3
Linum usitatissimumLus10015616Lus10037634
Malus domesticaMDP0000944874MDP0000921848
Manihot esculentacassava4.1_026281mcassava4.1_034020m
Medicago truncatulaMedtr2g100000.1
Mimulus guttatusmgv1a002369m
Oryza sativaLOC_Os05g46200.2LOC_Os05g46200.1LOC_Os05g46200.3
Panicum virgatumPavirv00010551mPavirv00046579m
Physcomitrella patensPp1s149_266V6.1Pp1s52_244V6.1Pp1s52_244V6.2
Phaseolus vulgarisPhvul.005G158700.1
Picea abiesMA_775331g0010MA_8535581g0010
Populus trichocarpaPotri.003G040000.1Potri.003G037000.1
Prunus persicappa002232m
Ricinus communis28694.m000663.153.29928694.m000663.153.29928694.m000663.62.15328694.m000663.62.153
Setaria italicaSi021395mSi021403m
Selaginella moellendorffii61485
Sorghum bicolorSb09g026870.1
Thellungiella halophilaThhalv10018211m
Vitis viniferaGSVIVT01016865001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny