y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G093800.1
FamilyCBM57
Protein PropertiesLength: 1071 Molecular Weight: 120718 Isoelectric Point: 7.0954
ChromosomeChromosome/Scaffold: 08 Start: 23601301 End: 23607135
DescriptionDi-glucose binding protein with Kinesin motor domain
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM57802231.4e-30
  MFINAGGEALNETDSSMKFLGDNYFEGGNVMQTNEPINEAGDCPFIYWSARIGSFSYRFNNLPPGDYFVDLHFAEIINTNGPKGMRVFNVYMQEEKVLSD
  FDIFSVVGANKPLQVVGLRVSVKEDGLIALRFEGVIGSPMVCGI
Full Sequence
Protein Sequence     Length: 1071     Download
MDNAQLNAFL QNPETHFPDF SITRGFDSEK CDLALNLDNP TSAMDEGEEE SFADLMLCDS    60
NSRLIPSGFS KSNCTDEIVM FINAGGEALN ETDSSMKFLG DNYFEGGNVM QTNEPINEAG    120
DCPFIYWSAR IGSFSYRFNN LPPGDYFVDL HFAEIINTNG PKGMRVFNVY MQEEKVLSDF    180
DIFSVVGANK PLQVVGLRVS VKEDGLIALR FEGVIGSPMV CGICVRKTQN IPVTQGLQEY    240
LKCNNCAAEI EVSSAQMKLV RTKVTDKYEK KIQELTTQCQ LKTHECHEAW MSLTAANEQL    300
EKVRMELDNK IFLTRTLDDT VGKQAENLKN ITSSYEHYKK YWAAEVNNLR EKIKIMKNEH    360
AQLSHEAHAC AESIPELNKM VTGVQALVEQ CEDLKVKYSE EQAKRKELYN QIQETKGNIR    420
VFCRCRPLSK EEISAGSAQV VDFDAAKDGD IGILTGASTR KTFKFDRVYT PKDNQVDVFA    480
DALPLVTSVL DGYNVCIFAY GQTGTGKTFT MEGTDQNRGV NYRTLEQLFH IAKERSETFM    540
YNISVSVLEV YNEQIRDLLS TSPTSKRLEI KQSAEGFHHV PGIVEAQVEN IKEVWNVLQI    600
GSNSRAVGSN NVNEHSSRSH CMLCIMVKSK NLMTGECTNS KLWLVDLAGS ERLAKTDAQG    660
ERLKEAQNIN KSLSALGDVV YALATKSSHI PYRNSKLTHL LQDSLGGDSK TLMFVQISPS    720
ERDISETLSS LNFATRVRGV ELGPAKRQVD TSELQKMKTM LEKARQESRS KEESLKKLEE    780
SLQNLESKAK GRDQVYRTQQ EKIKELEGQL ELKNSMHNQS EKQLSQLSDR LKGKEEISTA    840
LQLKVKELEA KIKERHQSDS ASYQQKVKEL ENKLKEQVQE SESHSLSLQL KIKELERKLK    900
EQEQNPDSIF LRQKIKELED RLREQEQQLQ CALARSFADT IAASPSEGKW RKDDESMNEA    960
EPHILRSSNS TSSRPLSHGL KQPRISDLVH EPRKKRYSRS GETENNMVMA ASLADKRARK    1020
SDPPKIARGV KTTKPGSLAA QGPVAHKRVI NRGQVHGAME RDSKKKIWSR *             1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01369KISc_KHC_KIF52.0e-106418736325+
cd00106KISc6.0e-122418738329+
smart00129KISc1.0e-139418746336+
pfam00225Kinesin5.0e-143424740326+
cd01366KISc_C_terminal0416743330+
Gene Ontology
GO TermDescription
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0007018microtubule-based movement
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN63715.101106111070hypothetical protein [Vitis vinifera]
EMBLCBI40845.109610701979unnamed protein product [Vitis vinifera]
RefSeqNP_179846.20771070871093kinesin motor protein-related [Arabidopsis thaliana]
RefSeqXP_002266404.1018361840PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002532381.101106811073ATP binding protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2h58_A04157422330A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3h4s_A04057801376A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_C04137801368A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_A04137801368A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cnz_B04137801368A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL9216582585087650
EL4429302655047660
DV9908452994727660
EH1942273095518590
ES8272772645778390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00213.1Aquca_015_00213.2
Arabidopsis thalianaAT2G22610.1AT2G22610.2
Brassica rapaBra038507Bra016076
Carica papayaevm.model.supercontig_229.5evm.model.supercontig_21.41
Capsella rubellaCarubv10022542mCarubv10022541m
Citrus clementinaCiclev10000147mCiclev10024772m
Citrus sinensisorange1.1g037169morange1.1g001679m
Fragaria vescamrna20704.1-v1.0-hybridmrna26561.1-v1.0-hybrid
Glycine maxGlyma01g02620.1Glyma09g33340.2
Gossypium raimondiiGorai.009G228400.1Gorai.002G032500.3Gorai.002G032500.2Gorai.002G032500.1
Linum usitatissimumLus10005582Lus10035954Lus10025708Lus10013714
Malus domesticaMDP0000317970
Manihot esculentacassava4.1_032042mcassava4.1_000724m
Medicago truncatulaAC174330_12.1AC146711_18.1AC146711_37.1Medtr5g031470.1
Mimulus guttatusmgv1a000533m
Physcomitrella patensPp1s9_137V6.1Pp1s403_54V6.1
Phaseolus vulgarisPhvul.002G145000.1
Picea abiesMA_180169g0010
Populus trichocarpaPotri.002G110600.2Potri.011G140000.1Potri.001G436200.1Potri.001G436200.2Potri.001G436200.4
Potri.002G110600.1
Prunus persicappa014706mppa015110m
Ricinus communis29591.m00013929235.m00023229596.m000713
Selaginella moellendorffii13900998850
Vitis viniferaGSVIVT01003948001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny