y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G101400.1
FamilyCBM43
Protein PropertiesLength: 478 Molecular Weight: 52620.9 Isoelectric Point: 6.6269
ChromosomeChromosome/Scaffold: 08 Start: 30180209 End: 30181811
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433634435.2e-25
  WCVLESYASNQDLIGQQTGWACARSDCTALQDGASCSNLDPDRTVSYAFNSYYQMNNQDEDACDFEGLATVVSKDPSTMSC
GH17233400
  IGVNWGTMTSHPLHPRIVVQLLKDNGFEKVKLFDSDPWMVGYLAGTGIEVMLGIPNDQLEFLSQDYGNAKDWVKENCTSHLRKGGVNIKYVAVGNEPFLT
  SYKGRFLKTTFPALKNIQKALNEAGLGNKIKAVVPQNADVYESKSDKPSDGVFRRDVKAVMAQIVRFLKENGAPFVVNIYPFISLTMNSKFPSDFAFFDG
  GHPIQDDNVQYNNVFEANFDTLIYALKDLGTPNLTILVGEVGWPTDGHKKANKNSAKKFYDGLFKVLASKKGTPLRPGEMDVYLFGLFDEDTKSIEPGNF
  ERHWGIFDFDGKPKFTMD
Full Sequence
Protein Sequence     Length: 478     Download
MAVLWAGALI LVATSVKVVA DNIGVNWGTM TSHPLHPRIV VQLLKDNGFE KVKLFDSDPW    60
MVGYLAGTGI EVMLGIPNDQ LEFLSQDYGN AKDWVKENCT SHLRKGGVNI KYVAVGNEPF    120
LTSYKGRFLK TTFPALKNIQ KALNEAGLGN KIKAVVPQNA DVYESKSDKP SDGVFRRDVK    180
AVMAQIVRFL KENGAPFVVN IYPFISLTMN SKFPSDFAFF DGGHPIQDDN VQYNNVFEAN    240
FDTLIYALKD LGTPNLTILV GEVGWPTDGH KKANKNSAKK FYDGLFKVLA SKKGTPLRPG    300
EMDVYLFGLF DEDTKSIEPG NFERHWGIFD FDGKPKFTMD ISGKGGDKHL VAAKGVKYLP    360
KQWCVLESYA SNQDLIGQQT GWACARSDCT ALQDGASCSN LDPDRTVSYA FNSYYQMNNQ    420
DEDACDFEGL ATVVSKDPST MSCRFNTQIK VDGATRLSFA QGAVPAISSS LTLFFLL*      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53090.000125533282+
pfam07983X82.0e-1436243281+
smart00768X83.0e-2736244586+
pfam00332Glyco_hydro_179.0e-7023340320+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN62816.1064534458hypothetical protein [Vitis vinifera]
GenBankEAZ37505.102044830456hypothetical protein OsJ_21839 [Oryza sativa Japonica Group]
RefSeqNP_001057968.102044830456Os06g0590600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002310612.1034777484predicted protein [Populus trichocarpa]
RefSeqXP_002530257.1034538459Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ur8_B0233423315A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3ur8_A0233423315A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3ur7_B0233423315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A0233423315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB4gzj_A0233423315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797198434234540
EX3456263091054100
GR4104643041054030
EX3458652911053920
GE474080296513450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00610.1.369.451Aquca_007_00315.1.404.484Aquca_003_00745.1.367.446Aquca_004_00628.1.371.452Aquca_018_00224.2.330.411
Aquca_018_00224.1.360.441Aquca_004_00435.1.371.450Aquca_114_00021.1.377.459Aquca_009_00540.1.366.447Aquca_004_00629.1.368.448
Arabidopsis lyrata913356.365.447479948.337.417329810.360.439495914.362.443340560.374.456
862228.371.456893776.366.447910127.375.455496695.369.449919046.365.444
Arabidopsis thalianaAT4G31140.1.365.447AT3G24330.1.382.462AT4G17180.1.359.438AT5G58090.1.362.443AT3G04010.1.374.456
AT5G18220.1.369.454AT5G20870.1.375.457AT1G64760.2.366.447AT1G64760.1.366.447AT2G19440.1.362.443
AT5G64790.1.369.449AT5G58480.1.363.442
Brachypodium distachyonBradi3g18220.1.368.449Bradi1g56270.1.376.457Bradi1g13232.1.375.458Bradi4g15460.1.372.456Bradi2g18420.1.369.448
Bradi3g03520.1.370.451Bradi1g06050.1.372.453Bradi1g60410.1.366.447Bradi1g37160.1.368.448Bradi2g18700.1.373.454
Bradi1g65197.1.373.452
Brassica rapaBra011249.365.447Bra020389.362.443Bra002673.364.445Bra015034.380.460Bra026232.357.436
Bra024022.366.449Bra036718.366.446Bra031954.374.455Bra002143.373.458Bra006581.376.461
Bra020132.372.452Bra002646.368.447Bra037795.369.449Bra031901.369.449
Carica papayaevm.model.supercontig_23.144.370.451evm.model.supercontig_148.14.365.446evm.model.supercontig_82.42.362.443evm.model.supercontig_91.73.360.441evm.model.supercontig_51.93.361.442
evm.model.supercontig_2.377
Capsella rubellaCarubv10004695m.365.447Carubv10015679m.380.460Carubv10026324m.362.443Carubv10006187m.360.439Carubv10013602m.362.443
Carubv10013538m.374.456Carubv10003257m.369.454Carubv10000767m.376.458Carubv10028073m.344.423Carubv10027803m.369.449
Citrus clementinaCiclev10008695m.255.336Ciclev10007363m.849.930Ciclev10008079m.383.464Ciclev10014935m.405.484Ciclev10019922m.366.447
Ciclev10008127m.364.445Ciclev10023781m.368.449Ciclev10027796m.368.447
Citrus sinensisorange1.1g011636m.365.446orange1.1g047337m.373.454orange1.1g010142m.405.484orange1.1g010789m.383.464orange1.1g011532m.366.447
orange1.1g011391m.364.445orange1.1g048257m.368.449orange1.1g011468m.368.447orange1.1g045344m.523.603
Cucumis sativusCucsa.116200.1.345.426Cucsa.356270.2.280.361Cucsa.356270.1.371.452Cucsa.310710.1.368.450Cucsa.319480.1.366.445
Cucsa.012240.1.343.420Cucsa.139490.1.372.451Cucsa.340580.1.367.448Cucsa.101480.1.371.451Cucsa.367020.1.372.452
Eucalyptus grandisEucgr.C04137.1.442.523Eucgr.C02145.1.369.451Eucgr.C02156.3.364.445Eucgr.C02156.2.364.445Eucgr.C02156.1.364.445
Eucgr.D00955.1.367.446Eucgr.K01479.1.369.450Eucgr.A02084.1.366.447Eucgr.C03182.1.321.402Eucgr.I00311.1.366.446
Eucgr.J01882.1.378.457
Fragaria vescamrna29858.1-v1.0-hybrid.348.429mrna19854.1-v1.0-hybrid.364.443mrna02065.1-v1.0-hybrid.373.454mrna21072.1-v1.0-hybrid.373.454mrna15460.1-v1.0-hybrid.362.444
mrna12970.1-v1.0-hybrid.364.442mrna28204.1-v1.0-hybrid.351.430mrna21133.1-v1.0-hybrid.367.447mrna21134.1-v1.0-hybrid.351.427
Glycine maxGlyma17g12985.1.864.945Glyma04g22190.1.387.468Glyma06g23474.1.367.448Glyma04g07820.2.371.453Glyma06g07890.1.364.446
Glyma07g39950.1.365.444Glyma09g01910.2.366.445Glyma11g29410.1.372.451Glyma14g16830.1.367.449Glyma15g12850.2.374.454
Glyma15g12850.1.369.449Glyma17g29760.1.364.446Glyma16g04680.1.365.446Glyma18g06570.1.370.449Glyma05g31860.1.368.447
Glyma02g07840.1.323.404Glyma06g15240.2.375.455Glyma13g17600.1.366.449Glyma16g26860.1.370.451Glyma17g04900.1.366.450
Gossypium raimondiiGorai.010G094500.1.365.447Gorai.012G043900.1.385.464Gorai.010G068800.1.872.953Gorai.004G097500.1.363.446Gorai.007G287700.1.368.449
Gorai.013G221700.1.362.444Gorai.013G202800.1.369.450Gorai.012G009200.1.367.450Gorai.013G270800.1.366.445Gorai.008G101400.1.363.443
Gorai.011G114400.1.368.449Gorai.011G114500.1.368.448Gorai.011G114600.1.368.448
Linum usitatissimumLus10039095.369.448Lus10017740.396.477Lus10024535.376.457Lus10033082Lus10020261.370.451
Lus10002633.369.450Lus10001183.372.455Lus10043075.372.455Lus10042269.372.451Lus10040579.345.427
Lus10031098.371.452Lus10028104.345.427Lus10026387.328.407Lus10006811.396.476Lus10005788.396.476
Malus domesticaMDP0000139990.368.447MDP0000180536.371.452MDP0000247204.368.447MDP0000303770.326.407MDP0000295938.357.439
MDP0000228162.380.461MDP0000201986.368.445MDP0000785544.367.448MDP0000547069.370.451MDP0000254562.398.477
MDP0000276748.366.445MDP0000195046.369.451MDP0000896503.366.445MDP0000501865.366.445MDP0000716700.366.446
MDP0000893827.364.443MDP0000245023.356.435MDP0000159387.366.445
Manihot esculentacassava4.1_027986m.113.194cassava4.1_006709m.362.443cassava4.1_021211m.252.333cassava4.1_006647m.365.444cassava4.1_006673m.365.444
cassava4.1_006689m.367.448cassava4.1_006628m.363.444cassava4.1_006682m.365.444cassava4.1_006416m.365.446cassava4.1_006515m.368.447
cassava4.1_027475m.373.453
Medicago truncatulaMedtr3g108600.1.351.433Medtr3g031770.1.364.443Medtr2g027560.1.369.448AC233669_25.1.372.454Medtr6g032820.1.363.443
Medtr7g085390.1.368.449Medtr4g124440.1.366.449Medtr3g095050.1.373.453Medtr8g092070.1.375.455
Mimulus guttatusmgv1a006384m.342.426mgv1a004426m.410.491mgv1a004416m.411.492mgv1a005873m.345.427mgv1a005395m.368.447
mgv1a018565m.297.378mgv1a027166m.364.447mgv1a022774m.363.442mgv1a005260m.367.447mgv1a006359m.323.405
mgv1a024405m.348.428mgv1a025912m.362.442mgv1a005370m.353.435mgv1a006003m.348.428
Oryza sativaLOC_Os08g23720.1.376.455LOC_Os11g36940.1.372.456LOC_Os09g09980.1.365.444LOC_Os08g12800.1.373.454LOC_Os03g45390.1.371.454
LOC_Os03g18520.1.375.454LOC_Os02g04670.1.369.450LOC_Os03g57880.3.377.458LOC_Os03g57880.2.377.458LOC_Os03g57880.1.377.458
LOC_Os03g27980.1.372.453LOC_Os07g07340.1.365.446LOC_Os06g39060.1.371.451LOC_Os05g45860.1.291.372
Panicum virgatumPavirv00040364m.408.487Pavirv00046668m.357.435Pavirv00039130m.369.450Pavirv00010253m.324.403Pavirv00024615m.367.446
Pavirv00060764m.369.450Pavirv00034646m.293.378Pavirv00002022m.320.399Pavirv00063043m.342.423Pavirv00046422m.374.455
Pavirv00016958m.366.446Pavirv00052629m.368.448Pavirv00000796m.278.359Pavirv00064019m.314.395Pavirv00058995m.373.454
Pavirv00009799m.373.454
Physcomitrella patensPp1s54_130V6.1.380.460Pp1s14_30V6.1.377.457Pp1s197_52V6.1.377.457Pp1s27_327V6.1.372.450Pp1s162_17V6.2.371.449
Pp1s162_17V6.1.371.449Pp1s157_11V6.1.367.444Pp1s109_183V6.1
Phaseolus vulgarisPhvul.003G176600.1.897.978Phvul.009G200400.1.369.456Phvul.009G099800.1.131.213Phvul.001G057100.2.280.362Phvul.001G057100.1.367.449
Phvul.006G135700.1.367.446Phvul.003G088600.1.368.447Phvul.006G072800.1.369.448Phvul.004G079100.1.367.448Phvul.001G109400.1.365.446
Phvul.009G138800.1.377.457Phvul.003G126100.1.366.450Phvul.002G266100.1.402.482
Picea abiesMA_17339g0040.332.415MA_43291g0010.369.450MA_10437110g0020.368.449MA_721956g0010
Populus trichocarpaPotri.018G077000.1.373.454Potri.018G072300.1.373.454Potri.016G002800.3.368.447Potri.016G002800.1.368.447Potri.006G002100.1.368.447
Potri.018G000900.1.382.465Potri.006G216700.1.367.448Potri.018G150400.1.364.445Potri.006G280700.2.342.425Potri.006G280700.1.378.461
Potri.006G080600.2.364.446Potri.006G080600.1.364.446Potri.019G032900.3.266.347Potri.019G032900.2.367.448Potri.019G032900.1.395.476
Potri.013G059700.1.367.448Potri.009G076500.1.365.444Potri.016G002800.2.368.437Potri.007G078900.1.372.452Potri.002G000700.1
Prunus persicappa004814m.368.450ppa004783m.373.452ppa004964m.364.445ppa017632m.369.450ppa004643m.366.444
ppa005641m.338.419ppb004066m.366.445ppa017706m.346.425ppa018453m.367.446
Ricinus communis28226.m000880.369.45129836.m000569.365.44429848.m004686.373.45429739.m003664.380.46129777.m000270.363.445
29950.m001151.367.44827758.m000328.369.44930156.m001714.278.357
Setaria italicaSi013645m.369.450Si026278m.372.457Si017029m.370.451Si035350m.378.459Si029637m.367.446
Si040250m.373.452Si013637m.367.446Si035361m.375.456Si029650m.370.451Si008675m.367.447
Si035326m.375.456Si024796m.377.458
Selaginella moellendorffii171231.381.45832959.349.42889756.387.467231117.357.43886140.369.449
236210.379.458267465.357.437
Sorghum bicolorSb01g012900.1.377.458Sb02g017290.1.368.447Sb04g003170.2.369.450Sb04g003170.1.369.450Sb02g003910.1.373.454
Sb07g006340.1.374.455Sb05g022490.1.392.464Sb01g033200.1.373.454Sb01g005610.1.376.459Sb10g022940.1.380.460
Sb09g026690.1.372.453Sb01g038220.1.372.451
Thellungiella halophilaThhalv10024947m.357.436Thhalv10025047m.365.447Thhalv10013422m.362.443Thhalv10002822m.427.507Thhalv10020592m.374.456
Thhalv10015448m.371.456Thhalv10022665m.366.447Thhalv10013340m.373.454Thhalv10012621m.365.444Thhalv10004092m.369.449
Vitis viniferaGSVIVT01002584001.290.369GSVIVT01015435001.864.944GSVIVT01034245001.364.445GSVIVT01033384001.367.448GSVIVT01014995001.363.444
GSVIVT01030073001.368.447
Zea maysAC217887.3_FGT004.373.454AC159612.1_FGT007.337.418
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)