y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G143800.2
FamilyCE8
Protein PropertiesLength: 524 Molecular Weight: 58076.4 Isoelectric Point: 8.6752
ChromosomeChromosome/Scaffold: 08 Start: 39586140 End: 39588178
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82523352.3e-26
  VTVSQDGSGNFTTINDAISAAPNNTNGANGYFVIYITAGVYQEYVSIAKNKKYLMMIGDGINQTIITGNRSVVDGWTTFNSATF
CE83365040
  GYQDTLYTHSLRQFYRDCDIYGTVDFIFGNAAVVLQNCNIYPRQPMSGQFNAITAQGRTDPNQNTGISIHDCNIMPADDLASSNTTFKTYLGRPWKEYSR
  TVYMQNFMGSLIDPAGWREWNGDFALSTLYYAEYDNSGPGSNTSSRVTWSGYHTINATDAANFTVSGFL
Full Sequence
Protein Sequence     Length: 524     Download
MASKLTCSIL MICHLVLLPL FIYPSFADSL PSDPVSPGSV CKSTPDPSYC RSVLPNQTTN    60
VYNYGRFSVR KSLSQSRKFV NLVEKYLRKY RQSVSVSAIR ALEDCRFLAD LNMDFLLSSF    120
KTVNATSSTL SNVEADDVQT FLSAILTNQQ TCLDGLQSTS SAWSIRNGIS VPLTNDTKLY    180
SVSLALFTRG WVPKRKKKAT WQPSSSKQLG FKHGRLLMRM SSRARSIYET VSRRKLLQTN    240
NTDEEVLVSD IVTVSQDGSG NFTTINDAIS AAPNNTNGAN GYFVIYITAG VYQEYVSIAK    300
NKKYLMMIGD GINQTIITGN RSVVDGWTTF NSATFGYQDT LYTHSLRQFY RDCDIYGTVD    360
FIFGNAAVVL QNCNIYPRQP MSGQFNAITA QGRTDPNQNT GISIHDCNIM PADDLASSNT    420
TFKTYLGRPW KEYSRTVYMQ NFMGSLIDPA GWREWNGDFA LSTLYYAEYD NSGPGSNTSS    480
RVTWSGYHTI NATDAANFTV SGFLLGNDWL PNTGVPYTAS LLA*                     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02416PLN024161.0e-12725517547+
PLN02301PLN023016.0e-1398521568+
pfam01095Pectinesterase2.0e-156252507300+
PLN02713PLN0271301523570+
PLN03043PLN03043036522551+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF42040.1015221564pectin methylesterase 3 [Pyrus communis]
RefSeqXP_002268492.103952334557PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302726.1015221558predicted protein [Populus trichocarpa]
RefSeqXP_002320332.102852227560predicted protein [Populus trichocarpa]
RefSeqXP_002523112.101952222566Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A02545217315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A02445211319A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_B0.000000000006336511151339A Chain A, Pectin Methylesterase From Carrot
PDB2ntq_A0.000000000006336511151339A Chain A, Pectin Methylesterase From Carrot
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT4655982761633950
EY19745725512440
EX16465525512440
DT4639531983285240
DT4655991983285240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00168.2Aquca_013_00088.2
Arabidopsis lyrata333607.265.369333607.265.369
Citrus sinensisorange1.1g045655morange1.1g041181m
Fragaria vescamrna21487.1-v1.0-hybrid
Gossypium raimondiiGorai.009G039100.2Gorai.008G143800.2.252.335Gorai.008G143800.2.252.335
Linum usitatissimumLus10001466Lus10029867Lus10020679Lus10037458
Medicago truncatulaMedtr1g088290.1.243.374Medtr1g088290.1.243.374
Panicum virgatumPavirv00064468m
Picea abiesMA_8928694g0010MA_10428884g0010MA_5090144g0010MA_86577g0010.189.276MA_9819944g0010
MA_86577g0010.189.276
Populus trichocarpaPotri.002G202500.2.247.357Potri.002G202500.2.247.357
Ricinus communis30190.m010812.219.33130190.m010812.219.331
Setaria italicaSi001381m.139.287Si001381m.139.287
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny