y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G157400.2
FamilyCE16
Protein PropertiesLength: 272 Molecular Weight: 29960.8 Isoelectric Point: 9.3055
ChromosomeChromosome/Scaffold: 08 Start: 42047198 End: 42051087
DescriptionGDSL-motif lipase/hydrolase 6
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE16422472.7e-21
  IQEQLRQFKTLIEQKAINRSVVERSLFFLESGSNDIFNYFLPLDTPKLDPDAYVEAMVKEVTNLTDQIYKVGARRIVVFSLGPVGCVPARALLPAAPIKR
  CYGKMNAMVKKYNKGLESLVNDIPRRHPGAIGVYGAVYDTVQHLRAAPTRYGFSNVSSACCGDGPLGGEVQCGKEGYKICQNPQGFLFWDYFHPTQHTYE
  LISKAL
Full Sequence
Protein Sequence     Length: 272     Download
MVVAKSIHQT DSTLLALGVV FCKEPIKTGL VIDGTPQGVL PIQEQLRQFK TLIEQKAINR    60
SVVERSLFFL ESGSNDIFNY FLPLDTPKLD PDAYVEAMVK EVTNLTDQIY KVGARRIVVF    120
SLGPVGCVPA RALLPAAPIK RCYGKMNAMV KKYNKGLESL VNDIPRRHPG AIGVYGAVYD    180
TVQHLRAAPT RYGFSNVSSA CCGDGPLGGE VQCGKEGYKI CQNPQGFLFW DYFHPTQHTY    240
ELISKALWEG KKSRIRPINV KTLTNLTLAL A*                                  300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3240COG32409.0e-1167247184+
cd01847Triacylglycerol_lipase_like2.0e-1926244222+
PLN03156PLN031562.0e-2638247220+
cd01846fatty_acyltransferase_like3.0e-3227247226+
cd01837SGNH_plant_lipase_like7.0e-6834250223+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001047688.11e-3531265121359Os02g0669000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_177268.1028263119355GLIP6; carboxylesterase/ lipase [Arabidopsis thaliana]
RefSeqXP_002284004.1038269126357PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311487.10982651168predicted protein [Populus trichocarpa]
RefSeqXP_002532217.1038266126354zinc finger protein, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR171861224382610
GR174918224382610
GR177361219432610
JG076411224382610
GR174856189732610
Orthologous Group
SpeciesID
Gossypium raimondiiGorai.008G157400.1
Selaginella moellendorffii11607185808231712
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny